BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0810 (665 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10841| Best HMM Match : C1_1 (HMM E-Value=3.2) 28 5.9 SB_49209| Best HMM Match : Vicilin_N (HMM E-Value=0.23) 28 7.9 >SB_10841| Best HMM Match : C1_1 (HMM E-Value=3.2) Length = 544 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/47 (25%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = -1 Query: 275 WN*LIYEMKYTIYNFSFHNI-CPYDGWIHRIRIFSPCCLSNCFPWMV 138 W +IY + Y +++ + H++ C + + SP C++ C W V Sbjct: 290 WRVIIYYVHYGMHSMACHHLLCALRDAFNGVST-SPMCITGCIQWRV 335 >SB_49209| Best HMM Match : Vicilin_N (HMM E-Value=0.23) Length = 197 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 123 MSKSSCFFLISNANCSIEIRISKTKNY 43 M+KSS F I+ +NC +E+R+ K + Sbjct: 1 MAKSSRTFTIAISNCYVEVRLRKLNGF 27 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,205,686 Number of Sequences: 59808 Number of extensions: 413534 Number of successful extensions: 986 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 855 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 982 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1717720750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -