BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0810 (665 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 23 3.5 DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 23 3.5 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 23 3.5 AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase prec... 23 3.5 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 6.0 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 6.0 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 22 6.0 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 21 8.0 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 21 8.0 AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodo... 21 8.0 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 22.6 bits (46), Expect = 3.5 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +2 Query: 275 KWFFPRWAQAL 307 K+FFP+W Q L Sbjct: 648 KFFFPKWLQVL 658 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 22.6 bits (46), Expect = 3.5 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 65 GSLRLKIIFTYHITDTTP 12 G L +FTY+IT++TP Sbjct: 202 GELFDATVFTYNITNSTP 219 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 22.6 bits (46), Expect = 3.5 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 65 GSLRLKIIFTYHITDTTP 12 G L +FTY+IT++TP Sbjct: 217 GELFDATVFTYNITNSTP 234 >AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase precursor protein. Length = 156 Score = 22.6 bits (46), Expect = 3.5 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 65 GSLRLKIIFTYHITDTTP 12 G L +FTY+IT++TP Sbjct: 105 GELFDATVFTYNITNSTP 122 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = +1 Query: 475 TRSCSHCTRCAFSSYMEDLL 534 +R C+ RC S+++DL+ Sbjct: 143 SRGCTAVLRCVVPSFVKDLV 162 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = +1 Query: 475 TRSCSHCTRCAFSSYMEDLL 534 +R C+ RC S+++DL+ Sbjct: 143 SRGCTAVLRCVVPSFVKDLV 162 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 550 EKFCWLKGLPCNY*R 506 E C +KG+PC++ R Sbjct: 539 EHVCGVKGIPCSWGR 553 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 21.4 bits (43), Expect = 8.0 Identities = 9/32 (28%), Positives = 11/32 (34%) Frame = +3 Query: 135 FNHPWETVAQAAWRKYPNPMNPAVIGTDVVER 230 F+ W W +Y N GTD R Sbjct: 178 FSLGWTIAPMFGWNRYVPEGNMTACGTDYFNR 209 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.4 bits (43), Expect = 8.0 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +1 Query: 118 GHQNTHSTIH 147 GH+ HSTIH Sbjct: 192 GHRQRHSTIH 201 >AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodopsin protein. Length = 154 Score = 21.4 bits (43), Expect = 8.0 Identities = 9/32 (28%), Positives = 11/32 (34%) Frame = +3 Query: 135 FNHPWETVAQAAWRKYPNPMNPAVIGTDVVER 230 F+ W W +Y N GTD R Sbjct: 54 FSLGWTIAPMFGWNRYVPEGNMTACGTDYFNR 85 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,394 Number of Sequences: 438 Number of extensions: 3724 Number of successful extensions: 14 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20099475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -