BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0803 (693 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36072| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.38 SB_771| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.27) 28 8.3 >SB_36072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 32.3 bits (70), Expect = 0.38 Identities = 25/91 (27%), Positives = 40/91 (43%), Gaps = 1/91 (1%) Frame = -1 Query: 411 NYCIHIKHVM*LTYHASATYLSTSQCAITQGRCYTFSFRH*VIKLKKKQNCRYSP-TLHT 235 +Y +H H LT+++ T L+ T+ YT H RYS TL T Sbjct: 288 HYTLHYLHCTLLTFYSHYTILTLHATHTTRYAHYTLPTLH------ATHTTRYSHYTLLT 341 Query: 234 IFCSTSSRIEHAPHDHIMDPNATKYKHCTEL 142 ++ + ++R H + +AT+Y H T L Sbjct: 342 LYATHTTRYSHYTLRTLNATHATRYSHYTLL 372 >SB_771| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.27) Length = 506 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 587 FITHDIKRAMQLQAIHIALASSYLKNYCGYHIYMG 691 F+T+D+ R + + + S++ Y GYH+ MG Sbjct: 113 FLTNDLSRKLTQYHLIMGTTLSWVPPYHGYHLTMG 147 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,032,199 Number of Sequences: 59808 Number of extensions: 422354 Number of successful extensions: 873 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 795 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 873 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -