BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0800 (692 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) 72 4e-13 SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) 58 7e-09 SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38) 54 1e-07 SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) 53 2e-07 SB_39934| Best HMM Match : RRM_1 (HMM E-Value=6.5e-24) 48 5e-06 SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013) 46 4e-05 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_31413| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) 38 0.006 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 38 0.010 SB_37827| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_10895| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_877| Best HMM Match : RRM_1 (HMM E-Value=1e-15) 37 0.013 SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) 36 0.024 SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) 36 0.031 SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) 36 0.041 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.054 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 34 0.095 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 34 0.13 SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) 33 0.17 SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_47564| Best HMM Match : RRM_1 (HMM E-Value=0.23) 33 0.22 SB_34062| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.29 SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) 32 0.38 SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.38 SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.38 SB_18084| Best HMM Match : DUF801 (HMM E-Value=0.37) 31 0.67 SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_41060| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18) 31 1.2 SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0) 31 1.2 SB_2941| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_57661| Best HMM Match : RRM_1 (HMM E-Value=0.017) 30 1.5 SB_57208| Best HMM Match : Ion_trans (HMM E-Value=5.5e-34) 30 1.5 SB_15594| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_24418| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_28750| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33) 30 2.0 SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) 29 2.7 SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) 29 2.7 SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_46941| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_18026| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_47831| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_14704| Best HMM Match : Mak16 (HMM E-Value=9.3) 29 3.6 SB_1073| Best HMM Match : Ribosomal_L12 (HMM E-Value=2.2) 29 3.6 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 29 4.7 SB_55491| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_24568| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_42035| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_39378| Best HMM Match : VWA (HMM E-Value=0) 28 6.2 SB_7529| Best HMM Match : Toxin_29 (HMM E-Value=0.0017) 28 6.2 SB_46960| Best HMM Match : Neuromodulin (HMM E-Value=3.6) 28 8.3 SB_46435| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_20263| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_2375| Best HMM Match : Pentapeptide_2 (HMM E-Value=2.7) 28 8.3 >SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) Length = 842 Score = 72.1 bits (169), Expect = 4e-13 Identities = 34/87 (39%), Positives = 56/87 (64%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 428 F +GE++ V DP T RSRGF F+ FK P+++D V+ +G +++D KK Sbjct: 128 FEKFGELKECVVMRDPVTKRSRGFGFLTFKDPKAVDVVLNSGA-----QELDGKKMVTTT 182 Query: 429 GKIFVGGLSSEISDDEIRNFFSEFGTI 509 KIF+GGLS+ S+++++ +FS+FG + Sbjct: 183 KKIFIGGLSTNTSEEDMKKYFSQFGKV 209 >SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 58.4 bits (135), Expect = 5e-09 Identities = 32/92 (34%), Positives = 48/92 (52%), Gaps = 5/92 (5%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD-----PKK 413 F +GEI+ VK DPNT RSRGF F+ FK E V++ H I + + PK+ Sbjct: 135 FTRFGEIDFCEVKLDPNTRRSRGFGFVRFKKDEDAKNVLST-SHRIQGRLCEVRLPRPKE 193 Query: 414 AKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 K+FVG L ++ + +F++FG + Sbjct: 194 ELNVPKKLFVGRLPESTTEKTLMEYFAQFGEV 225 >SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) Length = 328 Score = 58.0 bits (134), Expect = 7e-09 Identities = 33/83 (39%), Positives = 43/83 (51%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 428 F YGE+ +++K D TGR RGFAF+ FK D + I K R Sbjct: 49 FSKYGELVGVDIKMDALTGRPRGFAFVQFKHQSEADAIDPKPAAPIG------KPPHLRV 102 Query: 429 GKIFVGGLSSEISDDEIRNFFSE 497 KIFVGGL E SD++IR +F + Sbjct: 103 KKIFVGGLKPETSDEKIREYFGK 125 Score = 53.2 bits (122), Expect = 2e-07 Identities = 22/51 (43%), Positives = 35/51 (68%) Frame = +2 Query: 512 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 664 E+E + + N+R+GFCF++F+SE V+ + +T I G +V+VKRA PK Sbjct: 132 EIEYITEHSSNRRRGFCFVSFDSEDTVDKICETQFHNIEGNKVEVKRALPK 182 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/54 (33%), Positives = 31/54 (57%) Frame = +3 Query: 255 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 416 AY ++ I T+ ++ R RGF F+ F + +++DK+ H I KV+ K+A Sbjct: 126 AYAPVKEIEYITEHSSNRRRGFCFVSFDSEDTVDKICETQFHNIEGNKVEVKRA 179 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/38 (50%), Positives = 24/38 (63%) Frame = +1 Query: 139 GDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHF 252 G S D N DD KLFVGGLS+ETT + L+++F Sbjct: 12 GTSLDSNKTRMTKDDDIGKLFVGGLSYETTKESLKEYF 49 Score = 34.3 bits (75), Expect = 0.095 Identities = 12/27 (44%), Positives = 21/27 (77%) Frame = +3 Query: 429 GKIFVGGLSSEISDDEIRNFFSEFGTI 509 GK+FVGGLS E + + ++ +FS++G + Sbjct: 29 GKLFVGGLSYETTKESLKEYFSKYGEL 55 Score = 33.5 bits (73), Expect = 0.17 Identities = 12/22 (54%), Positives = 20/22 (90%) Frame = +1 Query: 190 RKLFVGGLSWETTDKELRDHFG 255 +K+FVGGL ET+D+++R++FG Sbjct: 103 KKIFVGGLKPETSDEKIREYFG 124 >SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38) Length = 496 Score = 53.6 bits (123), Expect = 1e-07 Identities = 23/75 (30%), Positives = 50/75 (66%), Gaps = 11/75 (14%) Frame = +3 Query: 303 GRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKK-----------AKARHGKIFVGG 449 GRSRGF F+ +++ +S+++V+ +H +++++++PK+ A ++ KIFVGG Sbjct: 86 GRSRGFGFVTYESSDSVNEVLKKKDHVLDDREIEPKRSVPRDESGAPEAMSKTRKIFVGG 145 Query: 450 LSSEISDDEIRNFFS 494 L+S +++I+ +F+ Sbjct: 146 LASTTVEEDIKEYFN 160 Score = 42.7 bits (96), Expect = 3e-04 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = +3 Query: 261 GEIESINVKTD-PNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAK 419 GE+ +++K D N R RGFAF+ F E ++KV A H I K+ + KKA+ Sbjct: 169 GEVIDVDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYHEIRMKQCEVKKAE 222 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/46 (32%), Positives = 28/46 (60%) Frame = +2 Query: 533 KTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 670 K + +GF F+T+ES VN++LK + +E++ KR+ P+ + Sbjct: 83 KRDGRSRGFGFVTYESSDSVNEVLKKKDHVLDDREIEPKRSVPRDE 128 Score = 36.3 bits (80), Expect = 0.024 Identities = 12/21 (57%), Positives = 19/21 (90%) Frame = +1 Query: 190 RKLFVGGLSWETTDKELRDHF 252 RK+F+GGL+W TT++ L+D+F Sbjct: 50 RKIFIGGLNWNTTEEGLKDYF 70 Score = 35.5 bits (78), Expect = 0.041 Identities = 15/53 (28%), Positives = 33/53 (62%), Gaps = 1/53 (1%) Frame = +2 Query: 509 LEVEMPFDKTKNQR-KGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 664 ++V++ D+ +R +GF F+TF+++++V + I K+ +VK+A P+ Sbjct: 172 IDVDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYHEIRMKQCEVKKAEPQ 224 Score = 33.9 bits (74), Expect = 0.13 Identities = 26/87 (29%), Positives = 46/87 (52%), Gaps = 3/87 (3%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI*KWRCPLTKQRTKERASVSSHLNLSKS*MICLRL 611 KIF+GGL+ +++ ++++FS++GTI C + K+ + R S S L+ Sbjct: 51 KIFIGGLNWNTTEEGLKDYFSQWGTI--VDCVIMKRDGRSRGFGFVTYESSDSVNEVLK- 107 Query: 612 PKEQLVERRSM---*SVPHQNQMAPEA 683 K+ +++ R + SVP APEA Sbjct: 108 KKDHVLDDREIEPKRSVPRDESGAPEA 134 Score = 27.9 bits (59), Expect = 8.3 Identities = 9/21 (42%), Positives = 18/21 (85%) Frame = +1 Query: 190 RKLFVGGLSWETTDKELRDHF 252 RK+FVGGL+ T +++++++F Sbjct: 139 RKIFVGGLASTTVEEDIKEYF 159 >SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 420 Score = 53.2 bits (122), Expect = 2e-07 Identities = 30/87 (34%), Positives = 46/87 (52%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 428 F +GE+ES+ + G SR + F++FK + K + H IN K VD K++ Sbjct: 100 FEQFGEVESVRIMRT-FLGYSRNYGFVLFK-DDGPSKEVLKKSHVINGKTVDVGKSR-NF 156 Query: 429 GKIFVGGLSSEISDDEIRNFFSEFGTI 509 I+VGGL S ++ +R F +FG I Sbjct: 157 RVIYVGGLPSHFTEQTVREHFKKFGVI 183 Score = 39.1 bits (87), Expect = 0.003 Identities = 14/51 (27%), Positives = 29/51 (56%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 401 F YG++ +++ TD TG+S+G + + P +++K++ H I +V Sbjct: 339 FRPYGQVAKVHILTDRETGKSKGCGVVKLRHPGTVNKILEEPVHVIGKSQV 389 Score = 33.1 bits (72), Expect = 0.22 Identities = 12/41 (29%), Positives = 24/41 (58%) Frame = +3 Query: 387 NNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 N+ PK + +FVGGL+S ++ ++++F +FG + Sbjct: 66 NSTLPSPKDIEKNSRSVFVGGLASGTDEEGLKDYFEQFGEV 106 >SB_39934| Best HMM Match : RRM_1 (HMM E-Value=6.5e-24) Length = 343 Score = 48.4 bits (110), Expect = 5e-06 Identities = 26/85 (30%), Positives = 46/85 (54%) Frame = +3 Query: 300 TGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEI 479 +G+S+GFAF+ + E+++ V+ +H I+N V +K + + K+ + + S I + +I Sbjct: 79 SGKSKGFAFVRLRKKEAVESVLGRDDHVIDNSDVSMEK-QDTYRKVILKNIPSSIGESQI 137 Query: 480 RNFFSEFGTI*KWRCPLTKQRTKER 554 FS G I P +TKER Sbjct: 138 LEHFSSSGEIASVYIP-ENLKTKER 161 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +2 Query: 533 KTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEV 640 KTK +RKG C +TF S +++K K I G ++ Sbjct: 157 KTK-ERKGHCIVTFASVTEAFEVVKKRKHHIHGYDI 191 >SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 47.2 bits (107), Expect = 1e-05 Identities = 24/87 (27%), Positives = 45/87 (51%), Gaps = 21/87 (24%) Frame = +3 Query: 312 RGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA---------------------KARH 428 +GF F+ F+ P +I+ V+A H ++ K +DPK A A Sbjct: 142 KGFGFVTFRDPATIESVLAKKPHILDGKTIDPKPAVPRGPGQQAQTGAVMGGPQRGSAND 201 Query: 429 GKIFVGGLSSEISDDEIRNFFSEFGTI 509 GK+F+GGL+ ++++++ +FS +G + Sbjct: 202 GKVFIGGLAFGTTEEDLKEYFSTYGMV 228 Score = 36.7 bits (81), Expect = 0.018 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = +2 Query: 527 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 679 F++ KGF F+TF + +L + GK +D K A P+ GPG Sbjct: 134 FERRARMLKGFGFVTFRDPATIESVLAKKPHILDGKTIDPKPAVPR--GPG 182 Score = 32.3 bits (70), Expect = 0.38 Identities = 11/26 (42%), Positives = 22/26 (84%) Frame = +1 Query: 175 GRDDDRKLFVGGLSWETTDKELRDHF 252 G +D K+F+GGL++ TT+++L+++F Sbjct: 197 GSANDGKVFIGGLAFGTTEEDLKEYF 222 >SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013) Length = 665 Score = 45.6 bits (103), Expect = 4e-05 Identities = 21/45 (46%), Positives = 27/45 (60%) Frame = +3 Query: 291 DPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 425 D T R RGF F+ F++ S DK H INNKKV+ KKA+ + Sbjct: 5 DKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQPK 49 Score = 44.4 bits (100), Expect = 9e-05 Identities = 20/46 (43%), Positives = 27/46 (58%) Frame = +2 Query: 527 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 664 FDK + +GF F+TFESE + T I K+V+VK+A PK Sbjct: 4 FDKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQPK 49 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 45.6 bits (103), Expect = 4e-05 Identities = 22/60 (36%), Positives = 36/60 (60%) Frame = +2 Query: 509 LEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGGIG 688 LE++M D+ N+ KG+CF+ F +E +V+ L + GK+V++K+A G GG G Sbjct: 133 LEIKMVRDRETNKFKGYCFVNFPNEHIVDKLYLVRHIQVKGKDVEMKKAADL--GAGGRG 190 Score = 41.1 bits (92), Expect = 8e-04 Identities = 26/85 (30%), Positives = 48/85 (56%), Gaps = 12/85 (14%) Frame = +3 Query: 264 EIESINVKTDPNTGRSRGFAFIVFK-APESIDKVMAAGE-HTINNKKVDPKKAKARHG-- 431 ++ S+++ P G+SR F F+ F + ID ++ E H+I+NK+V+ K+A R Sbjct: 38 DVSSVSLAKTPE-GKSRKFCFVEFSNGSDIIDNIVFNFESHSIDNKQVEVKRAMPRDDPN 96 Query: 432 --------KIFVGGLSSEISDDEIR 482 K+F+GGL E S+++++ Sbjct: 97 ELAHVRTKKLFIGGLKDEHSEEDVK 121 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/26 (50%), Positives = 20/26 (76%), Gaps = 2/26 (7%) Frame = +1 Query: 181 DDDR--KLFVGGLSWETTDKELRDHF 252 DD + KLFVGGL+ +TT++ +R +F Sbjct: 3 DDSKLMKLFVGGLNEDTTEETVRAYF 28 Score = 28.3 bits (60), Expect = 6.2 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEF 500 K+FVGGL+ + +++ +R +F F Sbjct: 9 KLFVGGLNEDTTEETVRAYFKSF 31 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = +3 Query: 276 INVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 416 I + D T + +G+ F+ F +DK+ + K V+ KKA Sbjct: 135 IKMVRDRETNKFKGYCFVNFPNEHIVDKLYLVRHIQVKGKDVEMKKA 181 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 44.4 bits (100), Expect = 9e-05 Identities = 33/93 (35%), Positives = 49/93 (52%), Gaps = 15/93 (16%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVF---KAPESI--DKVMAAGEHTINNKKVDPKK 413 F AYGE+ + V D T +SRGF ++ F K ++ DKV G H I+ K+V+ K+ Sbjct: 34 FEAYGELTDVVVICDSATKKSRGFGYVTFADYKVTRNVLKDKV-ENGAHRIDGKEVEVKR 92 Query: 414 AKARHG----------KIFVGGLSSEISDDEIR 482 A R KIFVGGL + + ++I+ Sbjct: 93 AIPRDDNSATSHEKTKKIFVGGLPEDATKEDIQ 125 Score = 36.7 bits (81), Expect = 0.018 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 4/51 (7%) Frame = +2 Query: 530 DKTKNQRKGFCFITFESEQVVNDLLKTPKRT----IGGKEVDVKRATPKPD 670 D + +GF ++TF +V ++LK I GKEV+VKRA P+ D Sbjct: 48 DSATKKSRGFGYVTFADYKVTRNVLKDKVENGAHRIDGKEVEVKRAIPRDD 98 Score = 34.7 bits (76), Expect = 0.072 Identities = 16/32 (50%), Positives = 21/32 (65%) Frame = +1 Query: 157 NSAEAPGRDDDRKLFVGGLSWETTDKELRDHF 252 N E D KLFVGGL+ ETT++ LR++F Sbjct: 3 NRQENTNNDPRAKLFVGGLNRETTNETLREYF 34 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/45 (35%), Positives = 27/45 (60%) Frame = +2 Query: 530 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 664 D+TK+ +GF F+ +E ++L K + GK V+ K+ATP+ Sbjct: 147 DETKH--RGFAFVELNNEDQADELCCVKKIHVKGKMVEAKKATPR 189 Score = 30.3 bits (65), Expect = 1.5 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 K+FVGGL+ E +++ +R +F +G + Sbjct: 15 KLFVGGLNRETTNETLREYFEAYGEL 40 >SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 44.0 bits (99), Expect = 1e-04 Identities = 25/93 (26%), Positives = 45/93 (48%), Gaps = 6/93 (6%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNK--KVD---PK 410 F G + S + D TG+S G+AF+ + P+ +K V + NK KV P Sbjct: 47 FGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKAVREMNGARLQNKTLKVSFARPS 106 Query: 411 KAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 + ++ +++ GL ++ ++E+ F FG I Sbjct: 107 STEIKNANLYISGLPKDMKEEEVEALFKPFGKI 139 >SB_31413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 381 Score = 41.9 bits (94), Expect = 5e-04 Identities = 28/87 (32%), Positives = 45/87 (51%), Gaps = 5/87 (5%) Frame = +3 Query: 261 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKK----AKAR- 425 GEI ++ DP TG ++GFAF F S + + T+N+K + P + K+R Sbjct: 177 GEIREFRLQMDPATGLNKGFAFCTFTEQTSAYQAIT----TLNDKDIRPGRRLAICKSRS 232 Query: 426 HGKIFVGGLSSEISDDEIRNFFSEFGT 506 + ++FV G+ S +EI FS+ T Sbjct: 233 NSRLFVKGIPKRKSKEEIFQEFSKVTT 259 >SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 718 Score = 38.3 bits (85), Expect = 0.006 Identities = 19/58 (32%), Positives = 34/58 (58%) Frame = +3 Query: 261 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGK 434 G+I S+ V TDP G+S+GF F+ F+ PE ++ + + +N K++ ++ A K Sbjct: 133 GKIVSLKVMTDPE-GKSKGFGFVSFETPEEAEEAV----NVLNGKEIGGRRLWAGRAK 185 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 365 F YG I S V D + G S+GF F+ F +PE K + Sbjct: 232 FSPYGTISSAKVMKD-DKGNSKGFGFVCFSSPEEATKAV 269 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 37.5 bits (83), Expect = 0.010 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = +3 Query: 270 ESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 365 E++N+ TD TGR RGF F+ F + E ++K + Sbjct: 123 EAVNIITDRETGRPRGFGFVTFGSKEEMEKAI 154 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +2 Query: 530 DKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGG 682 D+ + +GF F+TF S E++ + + + + G+ + V A P+ D GG Sbjct: 130 DRETGRPRGFGFVTFGSKEEMEKAIDEFDGQDLDGRPMKVNEAKPRGDSGGG 181 >SB_37827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 628 Score = 37.5 bits (83), Expect = 0.010 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +3 Query: 261 GEIESINVKTDPNTGRSRGFAFIVFKAPESI 353 G +E++ + TD NTG+ R F F+ F +P S+ Sbjct: 481 GPLENVRIPTDKNTGQQRSFGFVEFSSPVSV 511 >SB_10895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 496 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/70 (32%), Positives = 37/70 (52%) Frame = -2 Query: 376 SPAAMTLSIDSGALNTMKANPRDLPVFGSVFTLILSISPYAQNDHGAPYLWSPSSAHQQK 197 SP A++ +D G +A +++P F TL L + P+A G P ++PSS H++ Sbjct: 371 SPDALSKGLDMGWGALSRAGVQEMPAFP---TLRLPLHPFASTGFGTPAFYNPSSYHRE- 426 Query: 196 VFCRHRVLGP 167 + VLGP Sbjct: 427 ---YYPVLGP 433 >SB_877| Best HMM Match : RRM_1 (HMM E-Value=1e-15) Length = 145 Score = 37.1 bits (82), Expect = 0.013 Identities = 20/56 (35%), Positives = 33/56 (58%), Gaps = 2/56 (3%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV--DPK 410 F YG IE +++ TG+S+GF ++ ++ ES + + AG H I+ K V +PK Sbjct: 83 FGPYGAIEDLSI-IRTQTGKSKGFGYVTYENAESAQRAL-AGTHIIDGKWVIAEPK 136 >SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) Length = 1313 Score = 36.3 bits (80), Expect = 0.024 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 365 F YG ++++++ TD SRGFA++ + PE +K + Sbjct: 1177 FSVYGRVKTVDLPTDRTNNLSRGFAYVEYVDPEECEKAL 1215 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/50 (28%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +2 Query: 515 VEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTPKRTIGGKEVDVKRATP 661 V++P D+T N +GF ++ + + E+ L I G+E+ V+ P Sbjct: 1186 VDLPTDRTNNLSRGFAYVEYVDPEECEKALKHMDGGQIDGQEIAVQSVLP 1235 >SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) Length = 291 Score = 35.9 bits (79), Expect = 0.031 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 K+FVGG+ E DD +R FF++FG I Sbjct: 11 KLFVGGIPYESGDDALRKFFAQFGEI 36 >SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 593 Score = 35.5 bits (78), Expect = 0.041 Identities = 25/115 (21%), Positives = 56/115 (48%), Gaps = 17/115 (14%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPES-------IDKVMAAGEH-----TIN 389 +F +G I I++ DP + +GFAF+ + PE+ ++ V+ G + N Sbjct: 121 AFHPFGPINKIDLSWDPLNMKHKGFAFVEYDLPEAAQLALEQMNGVLLGGRNIKVGRPSN 180 Query: 390 NKKVDP-----KKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI*KWRCPLTKQ 539 + P ++ ++ +I++ + ++ +D+I++ F FG + C L+K+ Sbjct: 181 VPQAAPLIEQFEQEAKKYARIYIASVHPDLLEDDIKSVFEAFGKV--VHCSLSKE 233 Score = 31.1 bits (67), Expect = 0.89 Identities = 11/41 (26%), Positives = 26/41 (63%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 371 F A+G++ ++ +P TG+ +G+ FI ++ +S + +A+ Sbjct: 219 FEAFGKVVHCSLSKEPMTGKHKGYGFIEYENQQSANDAIAS 259 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 35.1 bits (77), Expect = 0.054 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +3 Query: 273 SINVKTDPNTGRSRGFAFIVFKAPESIDKVM 365 S+ V TD TGR RGF F+ F + + +DK + Sbjct: 37 SVKVITDRETGRPRGFGFVTFGSEDEMDKAI 67 Score = 32.3 bits (70), Expect = 0.38 Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = +2 Query: 509 LEVEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTPKRTIGGKEVDVKRATPKPDGPGG 682 L V++ D+ + +GF F+TF SE ++ + K + G+ + V +A P+ + GG Sbjct: 36 LSVKVITDRETGRPRGFGFVTFGSEDEMDKAIDKFDGEDLDGRPMKVNKAQPRGERGGG 94 Score = 31.1 bits (67), Expect = 0.89 Identities = 15/64 (23%), Positives = 35/64 (54%), Gaps = 1/64 (1%) Frame = +2 Query: 500 WNYLEVEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTPKRTIGGKEVDVKRATPKPDGP 676 ++ ++V++ D+ + +GF F+TF S++ + D + + + G+ + V +A + Sbjct: 253 YDVVDVQVISDRETQRPRGFAFVTFGSKKNMEDAINELDGQEFDGRSMKVNQARSREQRG 312 Query: 677 GGIG 688 GG G Sbjct: 313 GGRG 316 Score = 28.3 bits (60), Expect = 6.2 Identities = 17/68 (25%), Positives = 34/68 (50%), Gaps = 3/68 (4%) Frame = +3 Query: 264 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKV---MAAGEHTINNKKVDPKKAKARHGK 434 ++ + V +D T R RGFAF+ F + ++++ + E + KV+ +++ + G Sbjct: 254 DVVDVQVISDRETQRPRGFAFVTFGSKKNMEDAINELDGQEFDGRSMKVNQARSREQRGG 313 Query: 435 IFVGGLSS 458 GG S Sbjct: 314 GRGGGYRS 321 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 34.3 bits (75), Expect = 0.095 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +3 Query: 264 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 365 ++ + V TD TGR RGF F+ F + E ++K + Sbjct: 29 DVVDVKVITDRETGRPRGFGFVTFGSKEEMEKAI 62 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 33.9 bits (74), Expect = 0.13 Identities = 22/94 (23%), Positives = 41/94 (43%), Gaps = 7/94 (7%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID-KVMAAGEHTINNKKVDPKKAKAR 425 F G + ++++ D T +G+ F+ F E D + + K + KA A Sbjct: 33 FLQSGPVVNVHMPKDRITQLHQGYGFVEFLGEEDADYAIKVMNMIKVYGKPIRVNKASAH 92 Query: 426 H------GKIFVGGLSSEISDDEIRNFFSEFGTI 509 + +F+G L +E+ + + + FS FG I Sbjct: 93 NKNLDVGANLFIGNLDTEVDEKLLYDTFSAFGVI 126 Score = 31.5 bits (68), Expect = 0.67 Identities = 18/51 (35%), Positives = 31/51 (60%), Gaps = 3/51 (5%) Frame = +3 Query: 246 SFWAYGEI-ESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--GEHTIN 389 +F A+G I ++ + D +TG S+GFAFI F + ++ D + A G++ N Sbjct: 119 TFSAFGVILQTPKIMRDSDTGNSKGFAFINFASFDASDAAIEAMNGQYLCN 169 >SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1309 Score = 33.9 bits (74), Expect = 0.13 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +2 Query: 512 EVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTPKRTIGGKEVDVKRATPK 664 EV + D KN+ KGF F++F E + + TIGGK+V A K Sbjct: 541 EVRVVKDPAKNKSKGFGFVSFVRREDAAKAIAEMDSVTIGGKQVKTNWAARK 592 Score = 33.1 bits (72), Expect = 0.22 Identities = 26/100 (26%), Positives = 45/100 (45%), Gaps = 22/100 (22%) Frame = +3 Query: 276 INVKTDPNTGRSRGFAFIVF-------KAPESIDKVMAAGEHTINN---KKVDPKKAKAR 425 + V DP +S+GF F+ F KA +D V G+ N +K +P + K Sbjct: 542 VRVVKDPAKNKSKGFGFVSFVRREDAAKAIAEMDSVTIGGKQVKTNWAARKNNPTQTKPL 601 Query: 426 ------------HGKIFVGGLSSEISDDEIRNFFSEFGTI 509 + ++VG L ++ D E++ FS++G+I Sbjct: 602 VWDDVFHQSSQLNTTVYVGNLPPDVKDYELQQMFSQYGSI 641 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 33.5 bits (73), Expect = 0.17 Identities = 22/84 (26%), Positives = 37/84 (44%), Gaps = 5/84 (5%) Frame = +3 Query: 261 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKK-----AKAR 425 G I + DP +G ++GFAF F + + ++NK++ P K Sbjct: 176 GHIYDFRLMIDPISGLTKGFAFCTFSNKDEAQNAV----KKLDNKEIRPGKRLGVCISVA 231 Query: 426 HGKIFVGGLSSEISDDEIRNFFSE 497 + ++FVG + S EI FS+ Sbjct: 232 NSRLFVGSIPKTKSKQEILEEFSK 255 >SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) Length = 171 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/56 (28%), Positives = 32/56 (57%), Gaps = 2/56 (3%) Frame = +3 Query: 393 KKVDPK--KAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI*KWRCPLTKQRTKER 554 KK+ PK + + G I++G + ++EI+ FF +FGT+ + R +K+ + + Sbjct: 84 KKIKPKGDEDELSPGVIYLGHIPHGFFENEIKKFFEQFGTVNRIRLSRSKKSARSK 139 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEH 380 F +G + I + + RS+G+AF+ F A + + K+ A H Sbjct: 118 FEQFGTVNRIRLSRSKKSARSKGYAFVEF-ACDEVAKIAADTMH 160 >SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1208 Score = 33.1 bits (72), Expect = 0.22 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +3 Query: 258 YGEIESINVKTDPNTGRSRGFAFIVFKAPES 350 YGEI ++N+ D TG+ +GF F+ ++ S Sbjct: 2 YGEIVNVNLVRDKKTGKQKGFCFLCYEDQRS 32 >SB_47564| Best HMM Match : RRM_1 (HMM E-Value=0.23) Length = 44 Score = 33.1 bits (72), Expect = 0.22 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +3 Query: 258 YGEIESINVKTDPNTGRSRGFAFIVFKAPES 350 YGEI ++N+ D TG+ +GF F+ ++ S Sbjct: 2 YGEIVNVNLVRDKKTGKQKGFCFLCYEDQRS 32 >SB_34062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 552 Score = 33.1 bits (72), Expect = 0.22 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 2/58 (3%) Frame = +3 Query: 342 PESI-DKVMAAGEHTIN-NKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 PE++ D+++ + ++N + D + K+FVGGL +I +DEI F FG++ Sbjct: 313 PENLADQIVPSLASSLNCSPNSDSEHIPRFSRKVFVGGLPPDIDEDEIHASFCRFGSL 370 >SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 32.7 bits (71), Expect = 0.29 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 365 F YG++ I + D NT SRGFAF+ F + M Sbjct: 36 FKKYGDLGDIYIPRDRNTHESRGFAFVRFYEKRDAEDAM 74 >SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) Length = 407 Score = 32.3 bits (70), Expect = 0.38 Identities = 14/75 (18%), Positives = 34/75 (45%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 428 F G +ES+ + D TG +GF +++F++ +++ + +K+ +K + Sbjct: 76 FTTCGNVESVRLIRDRKTGIGKGFGYVLFESKDAVVFALKMNNAEFKGRKIRVFPSKDKP 135 Query: 429 GKIFVGGLSSEISDD 473 F+ + D+ Sbjct: 136 QTEFISHIQVRFRDN 150 >SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 871 Score = 32.3 bits (70), Expect = 0.38 Identities = 20/83 (24%), Positives = 37/83 (44%) Frame = +3 Query: 261 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIF 440 G + V +P G SRGFAF+ + E +K G+ N ++V+ + +G Sbjct: 230 GNVTFAQVAINPANGGSRGFAFVDYATAEEAEK----GQRAHNGRQVEGSNIRVAYGS-- 283 Query: 441 VGGLSSEISDDEIRNFFSEFGTI 509 G + I ++ N + + T+ Sbjct: 284 PGRTGASILGSQLDNTQAGYTTV 306 >SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 32.3 bits (70), Expect = 0.38 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 371 F YG++ + + D T SRG AFI+F +S +AA Sbjct: 30 FERYGKVVKVTILRDKETRESRGVAFILFIDRQSAQNAVAA 70 >SB_18084| Best HMM Match : DUF801 (HMM E-Value=0.37) Length = 599 Score = 31.5 bits (68), Expect = 0.67 Identities = 15/63 (23%), Positives = 34/63 (53%) Frame = +1 Query: 73 NDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHF 252 ND+ A D++ ++ + G+ +NGG D+ ++++ + D+ ++ D E+ DH Sbjct: 180 NDDSASDVSIEDIIYGDDDNGGDDNDNYDNDDDYDGDNYND---ENDDYDHNDVEMADHM 236 Query: 253 GHT 261 H+ Sbjct: 237 DHS 239 >SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 783 Score = 31.5 bits (68), Expect = 0.67 Identities = 24/91 (26%), Positives = 44/91 (48%), Gaps = 3/91 (3%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI---NNKKVDPKKA 416 SF +G + +++K P G+ +AF+ F + K A + N+ K+ ++ Sbjct: 256 SFEKFGVVLDVDIKR-PARGQGNTYAFVKFADLDVAAKAKCAMQGQCIGRNHIKIGYGRS 314 Query: 417 KARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 + + +++VGGL IS E+ F FG I Sbjct: 315 Q-QTTRLWVGGLGPWISIPELEREFDRFGAI 344 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 31.5 bits (68), Expect = 0.67 Identities = 12/36 (33%), Positives = 24/36 (66%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI 353 +F +G +E +++ D +GRSRGF F++ ++ + I Sbjct: 28 AFEEFG-VEKVDILRDKESGRSRGFGFVLLQSADQI 62 >SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1291 Score = 31.1 bits (67), Expect = 0.89 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 KIF+GGL + +++D+++ S FG + Sbjct: 674 KIFIGGLPNYLNEDQVKELLSSFGEL 699 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +3 Query: 255 AYGEIESINVKTDPNTGRSRGFAF 326 ++GE+ + N+ D TG S+G+AF Sbjct: 695 SFGELRAFNLVKDSATGLSKGYAF 718 >SB_41060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 30.7 bits (66), Expect = 1.2 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +1 Query: 73 NDNFAQDITTDNQLNGNAENGGGDSQDH-NSAEAPGRDDD 189 ND+ DI D+ NGN + G D+ D N E G DDD Sbjct: 20 NDDDGDDIDDDDG-NGNGNDNGDDNDDDDNDDEGNGDDDD 58 >SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18) Length = 268 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 +IFV G + E ++ E+R FF E+G + Sbjct: 9 RIFVKGFNRETTESELRAFFEEYGVV 34 >SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 1026 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 371 F +G+I V D T S+G AF+ +++ ES+ + +AA Sbjct: 436 FKQFGDIAYCKVVVDHLTQHSKGSAFVKYRSAESVTQCLAA 476 >SB_2941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 4/65 (6%) Frame = +1 Query: 70 NNDNFAQDITTDNQLNGNAE----NGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKE 237 +ND D D+++NG + N GGD D + + DDD + G S++ D + Sbjct: 58 DNDGGDDDDDDDDEVNGGNDDDDFNNGGDCDDDDDDDDDDDDDDDDINKKGASYDDDDDD 117 Query: 238 LRDHF 252 D + Sbjct: 118 DDDGY 122 >SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 721 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Frame = +3 Query: 249 FWAYGEIESINVKTDPNTGRSRGFAFI---VFKAPESIDKVMAAGEHTINNKKVD 404 F YGEI++++V D TG +G+A + FK +S + + E N VD Sbjct: 313 FSDYGEIKNLHVNLDRRTGFIKGYALVEYETFKEAQSALEALNGAEMLGQNISVD 367 >SB_57661| Best HMM Match : RRM_1 (HMM E-Value=0.017) Length = 255 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 K+FVG +S ++++R FS FGTI Sbjct: 215 KLFVGMISKHAKEEDLRVMFSPFGTI 240 >SB_57208| Best HMM Match : Ion_trans (HMM E-Value=5.5e-34) Length = 722 Score = 30.3 bits (65), Expect = 1.5 Identities = 21/70 (30%), Positives = 30/70 (42%), Gaps = 1/70 (1%) Frame = -2 Query: 388 LMVCSPAAMTLSIDSGALNTMKANPRDLPVF-GSVFTLILSISPYAQNDHGAPYLWSPSS 212 L + P+A++ +I K P LPV G+ +T S +N H YLW Sbjct: 525 LPITFPSAVSGTISPYLDIVNKYTPHGLPVVRGNEYTPHGSPVARGKNTHKTGYLWPRER 584 Query: 211 AHQQKVFCRH 182 H +V C H Sbjct: 585 IHTTRVTCCH 594 >SB_15594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 672 Score = 30.3 bits (65), Expect = 1.5 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Frame = -3 Query: 681 PPGPSGFGVARFTSTSFPPIVLL---GVLSKSFTTCSDSNVMKQKPFLWFFVLSK 526 P G +G G+ R++S S P G +S S+T V ++ FL FFVL K Sbjct: 383 PIGVNGSGITRYSSLSVPFYCKFSSHGDVSLSYTIKKSVPVWHEEKFLSFFVLYK 437 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 30.3 bits (65), Expect = 1.5 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = +1 Query: 196 LFVGGLSWETTDKELRDHF 252 L+VGGL + T+++LRDHF Sbjct: 306 LYVGGLEGKVTEQDLRDHF 324 Score = 28.3 bits (60), Expect = 6.2 Identities = 8/25 (32%), Positives = 19/25 (76%) Frame = +3 Query: 435 IFVGGLSSEISDDEIRNFFSEFGTI 509 ++VGGL ++++ ++R+ F +FG + Sbjct: 306 LYVGGLEGKVTEQDLRDHFYQFGEL 330 >SB_24418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 705 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/59 (27%), Positives = 30/59 (50%), Gaps = 8/59 (13%) Frame = +1 Query: 70 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKL--------FVGGLSWE 222 NN+N D +DN + N++N ++ D+N+ R D ++ ++ GL+WE Sbjct: 613 NNNNNNNDNNSDNNSDNNSDNNSDNNSDNNNDNNSERGADPEIKRGKNPEGWIRGLNWE 671 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +1 Query: 70 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 189 NNDN + + +N N N N ++ D+NS + D Sbjct: 597 NNDNNSDNNNNNNNNNNNNNNNNDNNSDNNSDNNSDNNSD 636 >SB_28750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +1 Query: 70 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 189 NN+N + +N N N N ++ D NS E DDD Sbjct: 18 NNNNNNNNNNNNNNNNNNNNNNNNNNNDDNSDEDDDDDDD 57 >SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33) Length = 662 Score = 29.9 bits (64), Expect = 2.0 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +3 Query: 432 KIFVGGLSSEISDDEIRNFFSEFGTI 509 ++F+G L S + D ++ FS++GTI Sbjct: 358 QVFIGNLPSGVKDADVNEVFSKYGTI 383 >SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) Length = 298 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +3 Query: 246 SFWAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 347 +F +G+I + + D T + RGF F+ F+ E Sbjct: 24 AFIPFGDITDVQIPMDYTTSKHRGFGFVEFEFAE 57 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/51 (27%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +2 Query: 512 EVEMPFDKTKNQRKGFCFITFE-SEQVVNDLLKTPKRTIGGKEVDVKRATP 661 +V++P D T ++ +GF F+ FE +E + + + G+ + V A P Sbjct: 33 DVQIPMDYTTSKHRGFGFVEFEFAEDTAAAIDNMNESELFGRTIRVNLAKP 83 >SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) Length = 392 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +3 Query: 435 IFVGGLSSEISDDEIRNFFSEFGTI*KWRCPLTKQRTKER 554 +FVG + E S+++++ FSE G + +R ++ K + Sbjct: 27 VFVGNIPYEASEEQLKEIFSEVGPVISFRLVFDRETGKPK 66 >SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 828 Score = 29.5 bits (63), Expect = 2.7 Identities = 10/33 (30%), Positives = 22/33 (66%) Frame = +2 Query: 512 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT 610 +V++ +D + Q KGFCF+T +++ + ++T Sbjct: 303 KVDIMWDWQRQQCKGFCFVTMATQEEAQNAIQT 335 >SB_46941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +1 Query: 70 NNDNFAQDITTDNQLNGNAE-NGGGDSQDHNS 162 NND+ D T D+ N N + NGGG D+N+ Sbjct: 193 NNDDDDDDDTDDDDHNNNDDDNGGGGDDDNNN 224 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +1 Query: 73 NDNFAQDITTDNQLN-GNAENGGGDSQDHNS 162 +DNF DI+ D LN G A N + ++NS Sbjct: 335 HDNFNDDISNDGNLNGGGANNNNNKNNNYNS 365 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/52 (23%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +2 Query: 527 FDKTKNQRKGFCFITFESEQVVNDLL-KTPKRTIGGKEVDVKRATPKPDGPG 679 FD+ + +GF F+ ++ + +L + + G++V + A+P+ +G G Sbjct: 319 FDRESGESRGFGFVDYDDVETAKKVLSEMAGAEVDGRQVRLDFASPRTEGGG 370 >SB_18026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 621 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/46 (26%), Positives = 24/46 (52%) Frame = +3 Query: 267 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 404 I+ + K+ N G++ G AF+VFK+ K + I ++ ++ Sbjct: 361 IDLLKHKSGKNQGKNTGVAFVVFKSNNDASKALKMDRSYIGHRYIE 406 >SB_47831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +3 Query: 390 NKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTI 509 +K + K + K+FVG + ++ E+++FF FG + Sbjct: 66 SKDISKYKVVSNKCKVFVGNIGFKVRARELKDFFGYFGDV 105 >SB_14704| Best HMM Match : Mak16 (HMM E-Value=9.3) Length = 189 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +1 Query: 70 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 189 NN+N +I +N N N N ++ ++N+ + DDD Sbjct: 112 NNNNNNNNINNNNNNNNNNNNNNNNNNNNNNNDDDDDDDD 151 >SB_1073| Best HMM Match : Ribosomal_L12 (HMM E-Value=2.2) Length = 244 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +1 Query: 67 ANNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 189 A N+ +A+ +T +N N N N ++ ++N+ DDD Sbjct: 160 AINEKYAKIMTDNNNNNNNNNNNNNNNNNNNNNNNNNNDDD 200 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 267 IESINVKTDPNTGRSRGFAFIVFKAPES 350 + + V TD TGR RGF F+ +A ++ Sbjct: 107 VVDVRVITDRETGRPRGFGFVTLEAKKT 134 >SB_55491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 189 ++DN D DN NG+ ++ D D + +A DDD Sbjct: 61 DSDNNYDDNDDDNDDNGDDDDNDDDDDDDDDDDADDDDDD 100 >SB_24568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1109 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +1 Query: 76 DNFAQDITTDNQLNGNAENGG-GDSQDHNSAEAPGRDDD 189 D + D D+ + + +N G GD D+ AE G DDD Sbjct: 821 DYYYDDDDDDDDDDDDGDNDGDGDGDDYGDAENYGEDDD 859 >SB_42035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 415 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = -3 Query: 192 SVVIASWGLSTVMILRITATVLCISIKLV 106 ++++ S G++ L ITAT+LC SI L+ Sbjct: 267 TILLESSGVTLPKALHITATILCYSISLL 295 >SB_39378| Best HMM Match : VWA (HMM E-Value=0) Length = 2865 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +1 Query: 130 NGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRD 246 NGG + D + A R++ +LFV GL E ++ +LR+ Sbjct: 603 NGGKSTDDASDAAYELRNEGVELFVVGLGDENSEAQLRE 641 >SB_7529| Best HMM Match : Toxin_29 (HMM E-Value=0.0017) Length = 691 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +1 Query: 70 NNDNFAQDITTDNQLNGNAENGGGDSQD 153 +++++A D DN +NG+ ++GGGD D Sbjct: 585 DDEDYAGD--GDNDVNGDGDSGGGDDDD 610 >SB_46960| Best HMM Match : Neuromodulin (HMM E-Value=3.6) Length = 557 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 189 +N+N +DI N EN GG+S + N + DD+ Sbjct: 147 SNNNEDEDIQEVEDDNEGKENDGGESDEENDDDDEDGDDE 186 >SB_46435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 558 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 3/39 (7%) Frame = +3 Query: 258 YGEIESINVK---TDPNTGRSRGFAFIVFKAPESIDKVM 365 +GEIE PN G RG+ F+ FK E K + Sbjct: 410 FGEIEHFQFLFHGNGPNRGEPRGYCFVEFKKKEDARKAL 448 >SB_20263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +1 Query: 70 NNDNFAQDITTDNQLNGN--AENGGGDSQDHN 159 NNDN+ + DN N N NG DS D+N Sbjct: 90 NNDNYDNNGNNDNNDNYNNYDNNGNNDSNDNN 121 >SB_2375| Best HMM Match : Pentapeptide_2 (HMM E-Value=2.7) Length = 521 Score = 27.9 bits (59), Expect = 8.3 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +1 Query: 67 ANNDNFAQDITTDNQLNGNAENGGGD-SQDHNSAEAPGRDDDRK 195 +N+DN D +T N N N EN D S +NS + DD K Sbjct: 103 SNSDNSNTDNSTSN--NSNPENSTSDNSNSNNSNQDNSNSDDSK 144 Score = 27.9 bits (59), Expect = 8.3 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +1 Query: 67 ANNDNFAQDITTDNQLNGNAENGGGD-SQDHNSAEAPGRDDDRK 195 +N+DN D +T N N N EN D S +NS + DD K Sbjct: 289 SNSDNSNTDNSTSN--NSNPENSTSDNSNSNNSNQDNSNSDDSK 330 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,756,266 Number of Sequences: 59808 Number of extensions: 477147 Number of successful extensions: 3006 Number of sequences better than 10.0: 69 Number of HSP's better than 10.0 without gapping: 1542 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2804 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -