BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0798 (723 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF125965-1|AAL38962.1| 339|Caenorhabditis elegans Hypothetical ... 53 2e-07 AF098501-3|AAM69106.1| 275|Caenorhabditis elegans Hypothetical ... 32 0.36 AF098501-2|AAM69105.1| 298|Caenorhabditis elegans Hypothetical ... 32 0.36 AF098501-1|AAC67404.2| 548|Caenorhabditis elegans Hypothetical ... 32 0.36 AF125462-6|AAD12857.2| 239|Caenorhabditis elegans Hypothetical ... 29 4.4 >AF125965-1|AAL38962.1| 339|Caenorhabditis elegans Hypothetical protein H43I07.3 protein. Length = 339 Score = 53.2 bits (122), Expect = 2e-07 Identities = 39/104 (37%), Positives = 55/104 (52%), Gaps = 3/104 (2%) Frame = +2 Query: 413 PAYNEEKRLPPMLDETIEFLENRQKENPSYKYE*---S**VTEVKTAQLK*PRATP*NMV 583 PA NE +R+ MLD+ ++LE R +++ + YE T+ + A N+ Sbjct: 88 PAMNEVERIEIMLDDCCDYLEARAEKDKDFTYEIIVVDDGSTDETADIVVQIGARRQNLR 147 Query: 584 VTK*NA*S**RTEEKGGAVRLGIQSSRGATILFADADGASKFED 715 V K A KGGAV++G+ S G ILFADADGA+KF D Sbjct: 148 VLKMKA-----NRGKGGAVKMGVLHSSGKLILFADADGATKFAD 186 >AF098501-3|AAM69106.1| 275|Caenorhabditis elegans Hypothetical protein H28G03.2c protein. Length = 275 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +3 Query: 420 IMKKKDCHPCWMKQLSSWRTDKKKTLHTNMNNHSE 524 I+KKK+ M+ +++W +K K +H NM H + Sbjct: 4 IVKKKEAMKKQMEDMAAWELEKIKRIHANMPRHMQ 38 >AF098501-2|AAM69105.1| 298|Caenorhabditis elegans Hypothetical protein H28G03.2b protein. Length = 298 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +3 Query: 420 IMKKKDCHPCWMKQLSSWRTDKKKTLHTNMNNHSE 524 I+KKK+ M+ +++W +K K +H NM H + Sbjct: 27 IVKKKEAMKKQMEDMAAWELEKIKRIHANMPRHMQ 61 >AF098501-1|AAC67404.2| 548|Caenorhabditis elegans Hypothetical protein H28G03.2a protein. Length = 548 Score = 32.3 bits (70), Expect = 0.36 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +3 Query: 420 IMKKKDCHPCWMKQLSSWRTDKKKTLHTNMNNHSE 524 I+KKK+ M+ +++W +K K +H NM H + Sbjct: 277 IVKKKEAMKKQMEDMAAWELEKIKRIHANMPRHMQ 311 >AF125462-6|AAD12857.2| 239|Caenorhabditis elegans Hypothetical protein Y66H1A.2 protein. Length = 239 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 511 IIIVSDGSKDSTVKVAESYSIKYGSDKV 594 +IIV D S D T +A+ +YG DK+ Sbjct: 38 VIIVDDASPDGTQGIAKLLQKEYGDDKI 65 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,413,240 Number of Sequences: 27780 Number of extensions: 266965 Number of successful extensions: 676 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 655 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 676 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1697838058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -