BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0796 (685 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY334007-1|AAR01132.1| 202|Anopheles gambiae odorant receptor 1... 27 0.42 AY334006-1|AAR01131.1| 202|Anopheles gambiae odorant receptor 1... 27 0.42 AY334005-1|AAR01130.1| 202|Anopheles gambiae odorant receptor 1... 27 0.42 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 26 1.3 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 24 5.1 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 24 5.1 AY825778-1|AAV70341.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825777-1|AAV70340.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825776-1|AAV70339.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825775-1|AAV70338.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825774-1|AAV70337.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825773-1|AAV70336.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825772-1|AAV70335.1| 162|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825771-1|AAV70334.1| 162|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825770-1|AAV70333.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825769-1|AAV70332.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825768-1|AAV70331.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825767-1|AAV70330.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825764-1|AAV70327.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825763-1|AAV70326.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825760-1|AAV70323.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825759-1|AAV70322.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825758-1|AAV70321.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825757-1|AAV70320.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825756-1|AAV70319.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825755-1|AAV70318.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825754-1|AAV70317.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825753-1|AAV70316.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825752-1|AAV70315.1| 144|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825751-1|AAV70314.1| 144|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825748-1|AAV70311.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825747-1|AAV70310.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825746-1|AAV70309.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825745-1|AAV70308.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825744-1|AAV70307.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825743-1|AAV70306.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825742-1|AAV70305.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825741-1|AAV70304.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825740-1|AAV70303.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825739-1|AAV70302.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825738-1|AAV70301.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825737-1|AAV70300.1| 160|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825736-1|AAV70299.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY825735-1|AAV70298.1| 161|Anopheles gambiae alanyl-tRNA synthe... 23 6.8 AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylch... 23 6.8 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 9.0 AY825655-1|AAV70218.1| 152|Anopheles gambiae olfactory receptor... 23 9.0 AY825643-1|AAV70206.1| 167|Anopheles gambiae olfactory receptor... 23 9.0 AY705404-1|AAU12513.1| 406|Anopheles gambiae nicotinic acetylch... 23 9.0 >AY334007-1|AAR01132.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 27.5 bits (58), Expect = 0.42 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 64 INSCSHKANCSLII*KNGN*SENVLREMQMLFGIWLFKIFM 186 I +C K NC+L K VLR M +F + +F +F+ Sbjct: 70 IQACLRKLNCTLYHPKQREEFSPVLRSMSGVFWLMIFLMFV 110 >AY334006-1|AAR01131.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 27.5 bits (58), Expect = 0.42 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 64 INSCSHKANCSLII*KNGN*SENVLREMQMLFGIWLFKIFM 186 I +C K NC+L K VLR M +F + +F +F+ Sbjct: 70 IQACLRKLNCTLYHPKQREEFSPVLRSMSGVFWLMIFLMFV 110 >AY334005-1|AAR01130.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 27.5 bits (58), Expect = 0.42 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 64 INSCSHKANCSLII*KNGN*SENVLREMQMLFGIWLFKIFM 186 I +C K NC+L K VLR M +F + +F +F+ Sbjct: 70 IQACLRKLNCTLYHPKQREEFSPVLRSMSGVFWLMIFLMFV 110 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/53 (20%), Positives = 26/53 (49%) Frame = +2 Query: 512 KRESRQKNNDHRSNKEKTSKQASEEH*K*VNEICHRRPREDDGCIEKQKILRI 670 ++E R+K R +EK ++ + + E R RE + E+++++ + Sbjct: 489 EKEQREKEERERQQREKEQREREQREKEREREAARERERERERERERERMMHM 541 Score = 25.0 bits (52), Expect = 2.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 480 GILRCSC*CQPKEKVDRKIMTTGPTKRKLPNRQAK 584 G+L+ C + EK D + T P+ R+LPN + + Sbjct: 2 GVLKTQC--REGEKEDSEGTGTSPSYRRLPNDETR 34 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.8 bits (49), Expect = 5.1 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 616 MAYFVNLFSMFFACLFGSFL 557 M Y + L +CLFG+FL Sbjct: 505 MGYLIKLAQHSHSCLFGTFL 524 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.8 bits (49), Expect = 5.1 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 616 MAYFVNLFSMFFACLFGSFL 557 M Y + L +CLFG+FL Sbjct: 505 MGYLIKLAQHSHSCLFGTFL 524 >AY825778-1|AAV70341.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825777-1|AAV70340.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825776-1|AAV70339.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825775-1|AAV70338.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825774-1|AAV70337.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825773-1|AAV70336.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825772-1|AAV70335.1| 162|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 162 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825771-1|AAV70334.1| 162|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 162 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825770-1|AAV70333.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825769-1|AAV70332.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825768-1|AAV70331.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825767-1|AAV70330.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825764-1|AAV70327.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825763-1|AAV70326.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825760-1|AAV70323.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825759-1|AAV70322.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825758-1|AAV70321.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825757-1|AAV70320.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825756-1|AAV70319.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825755-1|AAV70318.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825754-1|AAV70317.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825753-1|AAV70316.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKVVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825752-1|AAV70315.1| 144|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 144 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825751-1|AAV70314.1| 144|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 144 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825748-1|AAV70311.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825747-1|AAV70310.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825746-1|AAV70309.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825745-1|AAV70308.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825744-1|AAV70307.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKVVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825743-1|AAV70306.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825742-1|AAV70305.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825741-1|AAV70304.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825740-1|AAV70303.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825739-1|AAV70302.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825738-1|AAV70301.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825737-1|AAV70300.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825736-1|AAV70299.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY825735-1|AAV70298.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +1 Query: 295 DPCIKRLRESCSFRNLVIRSQKQLMDEISNGHEPAIKIEYVN 420 DP + + E C+ + + +R ++E+ G E + ++ N Sbjct: 11 DPLAQYVFEPCTGKIVALRFNNAFVEEVQAGQECGVILDRTN 52 >AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 2 protein. Length = 569 Score = 23.4 bits (48), Expect = 6.8 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = +2 Query: 182 LWSEHKWQGH 211 +W EH+WQ H Sbjct: 86 IWLEHEWQDH 95 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 9.0 Identities = 12/49 (24%), Positives = 26/49 (53%), Gaps = 4/49 (8%) Frame = +1 Query: 373 EISNGHEPAIKIEYVNEAEKDSSEP----ELTRDSVYEEVEFLDVPVDV 507 E+ H+P+ +E+ + + S E+ +V+ +++D+PVDV Sbjct: 977 ELIKQHKPSTILEFRPKHQGPSEVQLHFLEMLTKAVHNLFQYMDIPVDV 1025 >AY825655-1|AAV70218.1| 152|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 152 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -2 Query: 423 FIYILNFYCWFMAITYFVHQL 361 F+Y L FY W I Y V+ + Sbjct: 69 FLYELPFYDWSTTIGYVVNMM 89 >AY825643-1|AAV70206.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -2 Query: 423 FIYILNFYCWFMAITYFVHQL 361 F+Y L FY W I Y V+ + Sbjct: 81 FLYELPFYDWSTTIGYVVNMM 101 >AY705404-1|AAU12513.1| 406|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 9 protein. Length = 406 Score = 23.0 bits (47), Expect = 9.0 Identities = 7/23 (30%), Positives = 14/23 (60%) Frame = +2 Query: 164 YGYLKYLWSEHKWQGHTEVYGEM 232 YG++K+ W++ K + YG + Sbjct: 86 YGWMKFSWNDPKLTWNPASYGNL 108 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 728,667 Number of Sequences: 2352 Number of extensions: 17038 Number of successful extensions: 122 Number of sequences better than 10.0: 49 Number of HSP's better than 10.0 without gapping: 119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 122 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -