BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0787 (720 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578795-1|AAT07300.1| 441|Anopheles gambiae Gbb-60A2 protein. 26 1.0 AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. 24 5.4 AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. 24 5.4 AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. 24 5.4 AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. 24 5.4 AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. 24 5.4 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 24 5.4 AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled ... 23 7.2 >AY578795-1|AAT07300.1| 441|Anopheles gambiae Gbb-60A2 protein. Length = 441 Score = 26.2 bits (55), Expect = 1.0 Identities = 16/59 (27%), Positives = 28/59 (47%), Gaps = 3/59 (5%) Frame = -1 Query: 330 SGSHHPRYQS-VGSLRASREVRPCCV*G--TDIFILFTIEDINPNQVNFSVAVLSGFGC 163 + ++H Q+ V + +R +PCC I +L+ I+D N N + V+ GC Sbjct: 382 NATNHALIQTLVHLMHPTRVPKPCCAPTKLNPISVLYHIDDANINLKKYKNMVVKSCGC 440 >AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.8 bits (49), Expect = 5.4 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +3 Query: 342 DNGDLREDLKIPDGDLGTQLRTDFDSGKELL 434 + GD ED+ PDGD G R FD+ K L Sbjct: 60 EEGDYTEDVTAPDGD-G---RWTFDTNKPAL 86 >AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.8 bits (49), Expect = 5.4 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +3 Query: 342 DNGDLREDLKIPDGDLGTQLRTDFDSGKELL 434 + GD ED+ PDGD G R FD+ K L Sbjct: 60 EEGDYTEDVTAPDGD-G---RWTFDTNKPAL 86 >AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.8 bits (49), Expect = 5.4 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +3 Query: 342 DNGDLREDLKIPDGDLGTQLRTDFDSGKELL 434 + GD ED+ PDGD G R FD+ K L Sbjct: 60 EEGDYTEDVTAPDGD-G---RWTFDTNKPAL 86 >AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. Length = 187 Score = 23.8 bits (49), Expect = 5.4 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +3 Query: 342 DNGDLREDLKIPDGDLGTQLRTDFDSGKELL 434 + GD ED+ PDGD G R FD+ K L Sbjct: 60 EEGDYTEDVTAPDGD-G---RWTFDTNKPAL 86 >AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.8 bits (49), Expect = 5.4 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +3 Query: 342 DNGDLREDLKIPDGDLGTQLRTDFDSGKELL 434 + GD ED+ PDGD G R FD+ K L Sbjct: 60 EEGDYTEDVTAPDGD-G---RWTFDTNKPAL 86 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 667 RQRGGGAPRSPSTTSVL 617 R GGG P +P TT++L Sbjct: 1145 RSGGGGGPVNPQTTALL 1161 >AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled receptor 4 protein. Length = 426 Score = 23.4 bits (48), Expect = 7.2 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +1 Query: 82 FPMQCSALRKNGFVMLKG 135 +P++ SA RK G +ML G Sbjct: 181 YPLRVSAARKRGKIMLGG 198 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 781,305 Number of Sequences: 2352 Number of extensions: 15251 Number of successful extensions: 57 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 57 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -