BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0781 (732 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 23 3.0 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 23 3.9 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 9.0 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 21 9.0 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 23.0 bits (47), Expect = 3.0 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = +1 Query: 31 VQIISCGADAFTVASVLVMGS 93 + +IS GADA+ + +V+G+ Sbjct: 320 IVVISAGADAYPPLAAIVLGA 340 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 22.6 bits (46), Expect = 3.9 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -1 Query: 273 PGERMGGSTASRRTPAPRFP 214 PG G + + + P PRFP Sbjct: 62 PGHHYGAAGSQQDMPYPRFP 81 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/34 (23%), Positives = 18/34 (52%) Frame = +2 Query: 365 NGNGQSIHKQCQRYRRPADMPHGSERIERQYERA 466 NG + H+ Q Y +P ++ +++Q ++A Sbjct: 15 NGGVEHPHQHQQHYGAAVQVPQQTQSVQQQSQQA 48 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 222 LGQAYDETPSIRPF 263 L + DE PS+RPF Sbjct: 870 LVEVLDEFPSVRPF 883 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +3 Query: 399 SVTDALQICHTA 434 S+T ALQ CH A Sbjct: 163 SITCALQFCHNA 174 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,123 Number of Sequences: 438 Number of extensions: 4416 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22779405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -