BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0780 (485 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value D50810-1|BAA09436.1| 944|Homo sapiens placental leucine aminope... 29 8.7 >D50810-1|BAA09436.1| 944|Homo sapiens placental leucine aminopeptidase protein. Length = 944 Score = 29.1 bits (62), Expect = 8.7 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -1 Query: 125 YAESYRLRQICYAVSGFVVLKNFILIYTEFIYPLQKSDV 9 YA ++ Q+ YA+ V L F Y E YPL+K D+ Sbjct: 300 YAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDL 338 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 61,512,741 Number of Sequences: 237096 Number of extensions: 1077025 Number of successful extensions: 1589 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1542 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1589 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 4384610846 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -