BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0777 (640 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0267 - 21430370-21430474,21430559-21430618,21430937-214310... 40 0.001 03_01_0249 - 1935355-1935827,1936129-1936330 39 0.003 01_04_0025 - 15199036-15199493,15199633-15199681,15199782-15199931 39 0.004 06_01_0897 - 6903294-6903401,6903781-6903855,6904239-6904379,690... 37 0.016 01_07_0080 - 40955222-40955676,40956123-40956171,40956282-40956443 37 0.016 11_06_0225 + 21451966-21452036,21452127-21452200,21452342-21452436 35 0.063 01_04_0032 + 15273716-15273865,15274658-15274706,15275737-15276188 32 0.44 11_02_0046 + 7711536-7711568,7711685-7711850,7712251-7712339,771... 31 0.58 01_06_0810 - 32141657-32142105,32142986-32143034,32144961-32145110 31 0.77 11_06_0577 - 25158833-25162864 30 1.8 02_02_0095 + 6716327-6716335,6717302-6717451,6717523-6717583,671... 30 1.8 06_03_0529 - 21788132-21788395,21788414-21788511,21789458-217899... 29 2.4 02_01_0689 + 5137506-5137591,5138641-5138709,5139489-5139580,513... 29 2.4 05_01_0123 - 846081-846167,846264-846404,846749-846866,847382-84... 27 9.5 04_03_1007 - 21670780-21671368,21671477-21671685 27 9.5 >02_04_0267 - 21430370-21430474,21430559-21430618,21430937-21431046, 21431220-21431295,21431541-21431594,21431935-21432006, 21432088-21432173,21432694-21432750,21432886-21432991 Length = 241 Score = 40.3 bits (90), Expect = 0.001 Identities = 24/62 (38%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Frame = +2 Query: 248 KELDFEPLIVDITKGEQYSSWFLEINPRGEIPVLKVKDALIPDSTRILDYLE-FYLDSDL 424 K L++E V++ KGE F+++NP +P L DA+I DS I YLE Y + L Sbjct: 35 KGLEYEYKAVNLLKGEHSDPEFMKVNPMKFVPALVDGDAVIGDSYAIALYLEDKYPEHPL 94 Query: 425 VP 430 +P Sbjct: 95 LP 96 >03_01_0249 - 1935355-1935827,1936129-1936330 Length = 224 Score = 39.1 bits (87), Expect = 0.003 Identities = 23/74 (31%), Positives = 39/74 (52%), Gaps = 1/74 (1%) Frame = +2 Query: 242 IRKELDFEPLIVDITKGEQYSSWFLEINPRGEIPVLKVKDALIPDSTRILDYL-EFYLDS 418 + K++ F+ VD++KGE S FL++ P G++P K + +S I Y+ + Y DS Sbjct: 24 LEKDVPFQVEPVDMSKGEHKSPSFLKLQPFGQVPAFKDSLTTVFESRAICRYICDQYADS 83 Query: 419 DLVPLINVSKDTKV 460 L+ +D V Sbjct: 84 GNKTLMGRKEDGAV 97 >01_04_0025 - 15199036-15199493,15199633-15199681,15199782-15199931 Length = 218 Score = 38.7 bits (86), Expect = 0.004 Identities = 25/78 (32%), Positives = 40/78 (51%) Frame = +2 Query: 257 DFEPLIVDITKGEQYSSWFLEINPRGEIPVLKVKDALIPDSTRILDYLEFYLDSDLVPLI 436 D+E + VD GEQ S +E NP G+IP L+ D ++ +S I Y+ S V L+ Sbjct: 28 DYELVTVDFLAGEQNSPEHVERNPFGKIPALQDGDLVLFESRAIAKYILRKYKSSKVDLL 87 Query: 437 NVSKDTKVVTTINKFREL 490 S D + ++ + E+ Sbjct: 88 RES-DIREAALVDVWTEV 104 >06_01_0897 - 6903294-6903401,6903781-6903855,6904239-6904379, 6904496-6904646,6905035-6905178,6905276-6905366, 6906071-6906308 Length = 315 Score = 36.7 bits (81), Expect = 0.016 Identities = 16/52 (30%), Positives = 31/52 (59%) Frame = +2 Query: 248 KELDFEPLIVDITKGEQYSSWFLEINPRGEIPVLKVKDALIPDSTRILDYLE 403 K L ++ +VD+ WFL+I+P G++P++K+++ + DS I +E Sbjct: 93 KHLPYDIKLVDLANKPD---WFLKISPEGKVPIVKLEEQWVADSDVITQAIE 141 >01_07_0080 - 40955222-40955676,40956123-40956171,40956282-40956443 Length = 221 Score = 36.7 bits (81), Expect = 0.016 Identities = 19/51 (37%), Positives = 29/51 (56%) Frame = +2 Query: 248 KELDFEPLIVDITKGEQYSSWFLEINPRGEIPVLKVKDALIPDSTRILDYL 400 K LDF+ + VD+ FL +NP G+IPVL+ D ++ +S I Y+ Sbjct: 29 KGLDFDLVPVDLRTAAHKQPHFLALNPFGQIPVLQDGDEVLYESRAINRYI 79 >11_06_0225 + 21451966-21452036,21452127-21452200,21452342-21452436 Length = 79 Score = 34.7 bits (76), Expect = 0.063 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +2 Query: 254 LDFEPLIVDITKGEQYSSWFLEINPRGEIPVL 349 +DFE + VD+ K E S F +INP G++P + Sbjct: 28 IDFEEVTVDLFKREHLSPEFKKINPMGQVPAI 59 >01_04_0032 + 15273716-15273865,15274658-15274706,15275737-15276188 Length = 216 Score = 31.9 bits (69), Expect = 0.44 Identities = 19/68 (27%), Positives = 34/68 (50%) Frame = +2 Query: 257 DFEPLIVDITKGEQYSSWFLEINPRGEIPVLKVKDALIPDSTRILDYLEFYLDSDLVPLI 436 ++E + VD++ GE + NP G++P + D + +S I Y+ SDL+ Sbjct: 28 EYEVVPVDMSTGEHKRPPHISRNPFGQVPAFEDGDLTLFESRAISKYILRKHGSDLLRES 87 Query: 437 NVSKDTKV 460 N+S+ V Sbjct: 88 NLSESAMV 95 >11_02_0046 + 7711536-7711568,7711685-7711850,7712251-7712339, 7712443-7712514,7712807-7712860,7713000-7713075, 7713238-7713299,7713445-7713504,7713663-7713773 Length = 240 Score = 31.5 bits (68), Expect = 0.58 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +2 Query: 248 KELDFEPLIVDITKGEQYSSWFLEINPRGEIPVL-KVKDALIPDSTRILDYLE-FYLDSD 421 K LD+E +++ EQ F ++NP +P L D ++ DS IL YLE Y Sbjct: 47 KGLDYEYKPINLLANEQSHPEFEKLNPMKYVPALVDGDDTVVVDSFAILLYLEDTYPQHP 106 Query: 422 LVP 430 L+P Sbjct: 107 LLP 109 >01_06_0810 - 32141657-32142105,32142986-32143034,32144961-32145110 Length = 215 Score = 31.1 bits (67), Expect = 0.77 Identities = 15/48 (31%), Positives = 27/48 (56%) Frame = +2 Query: 257 DFEPLIVDITKGEQYSSWFLEINPRGEIPVLKVKDALIPDSTRILDYL 400 ++E + +D +KGE + L NP G++P L+ D + +S I Y+ Sbjct: 28 EYEIVPLDFSKGEHKAPDHLARNPFGQVPALQDGDLFLWESRAICKYV 75 >11_06_0577 - 25158833-25162864 Length = 1343 Score = 29.9 bits (64), Expect = 1.8 Identities = 16/48 (33%), Positives = 27/48 (56%) Frame = +2 Query: 347 LKVKDALIPDSTRILDYLEFYLDSDLVPLINVSKDTKVVTTINKFREL 490 LK + I S RI +E + +++ +NVS+D ++T I K R+L Sbjct: 963 LKRHEETISSSVRIPRKIEKMVKMEVMYSVNVSRDGNMLTEIGKLRQL 1010 >02_02_0095 + 6716327-6716335,6717302-6717451,6717523-6717583, 6717646-6717725,6717802-6717903,6717982-6718471, 6718796-6719171,6720320-6720379,6720887-6721056, 6721287-6721340,6721384-6721523,6722362-6722511, 6722582-6722642,6722705-6722784,6722933-6723034, 6723111-6723612,6724401-6724776,6725419-6725493, 6726058-6726198,6726264-6726282 Length = 1065 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +2 Query: 311 FLEINPRGEIPVLKVKDALIPDSTRILDYL 400 FL++NP G+IPVL+ D + +S I Y+ Sbjct: 45 FLKMNPIGKIPVLETPDGPVFESNAIARYV 74 Score = 28.7 bits (61), Expect = 4.1 Identities = 15/46 (32%), Positives = 26/46 (56%) Frame = +2 Query: 311 FLEINPRGEIPVLKVKDALIPDSTRILDYLEFYLDSDLVPLINVSK 448 +L++NP G++P+L+ D + +S I Y+ L S P + SK Sbjct: 606 YLKMNPIGKVPILETPDGPVFESNAIARYV---LSSSHFPEVTRSK 648 >06_03_0529 - 21788132-21788395,21788414-21788511,21789458-21789953, 21790033-21790134,21790218-21790270,21790354-21790414, 21790491-21790640,21791298-21791350,21794125-21794152 Length = 434 Score = 29.5 bits (63), Expect = 2.4 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +2 Query: 311 FLEINPRGEIPVLKVKDALIPDSTRILDYL 400 FL++NP G+IPVL+ + + +S I Y+ Sbjct: 69 FLKMNPLGKIPVLETPEGAVFESNAIARYV 98 >02_01_0689 + 5137506-5137591,5138641-5138709,5139489-5139580, 5139967-5140289,5141373-5142479,5142593-5143279, 5144214-5144522,5145488-5145823,5146165-5146263, 5146676-5146940,5146950-5147104,5147666-5149723, 5150168-5150367,5150662-5150718,5150965-5151079 Length = 1985 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = +2 Query: 227 GFNGFIRKELDFEPLIVDITKGEQYSSW--FLE 319 GF G + + LDF + + + G Y SW FLE Sbjct: 967 GFPGMVSRPLDFRTIDIRLAMGAYYGSWEAFLE 999 >05_01_0123 - 846081-846167,846264-846404,846749-846866,847382-847528, 848439-848441,848590-848627,848808-848851,848959-849016 Length = 211 Score = 27.5 bits (58), Expect = 9.5 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +2 Query: 311 FLEINPRGEIPVLKVKDA-LIPDSTRILDYLE 403 FL+I+P G++PV D IPDS I +E Sbjct: 49 FLKISPEGKVPVFNGGDGKWIPDSDVITQVIE 80 >04_03_1007 - 21670780-21671368,21671477-21671685 Length = 265 Score = 27.5 bits (58), Expect = 9.5 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 3/65 (4%) Frame = +2 Query: 248 KELDFEPLIVDITKGEQYSSWFLEINPRGEIPVLKVKDALIP---DSTRILDYLEFYLDS 418 K +D+ V+ G+ + F +NP ++PV + +I D + LD L +L Sbjct: 22 KGIDYTSYHVNPLTGKNMNVAFFRMNPSAKLPVFQNGAHVIYRAFDIIQYLDRLSVHLSG 81 Query: 419 DLVPL 433 ++VP+ Sbjct: 82 EIVPV 86 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,531,361 Number of Sequences: 37544 Number of extensions: 238771 Number of successful extensions: 477 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 458 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 477 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1573040476 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -