BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0776 (716 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1861.05 |||carbohydrate kinase|Schizosaccharomyces pombe|chr... 26 4.7 SPBC646.13 |sds23|psp1, moc1|inducer of sexual development Sds23... 25 8.2 SPCC1840.05c |||phosphomannomutase |Schizosaccharomyces pombe|ch... 25 8.2 SPAC6F12.08c |||exocyst complex subunit Exo84|Schizosaccharomyce... 25 8.2 >SPBC1861.05 |||carbohydrate kinase|Schizosaccharomyces pombe|chr 2|||Manual Length = 747 Score = 26.2 bits (55), Expect = 4.7 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 12/58 (20%) Frame = -3 Query: 645 GRRLSVPNPNQCAA------FLIE*WLSSEVKMTISGKFLMPFLL------TSGKALN 508 G +++P P+ C+ LIE L V++ I+GK + P+LL + GK+LN Sbjct: 262 GTLVAIPTPHHCSIDYEKMEALIETCLQRSVQLGITGKNVTPWLLGELLRESKGKSLN 319 >SPBC646.13 |sds23|psp1, moc1|inducer of sexual development Sds23/Moc1|Schizosaccharomyces pombe|chr 2|||Manual Length = 408 Score = 25.4 bits (53), Expect = 8.2 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +1 Query: 436 ESQTVTVYLVLVVAFQCYMLWL 501 ES T L +VA QC+ LWL Sbjct: 303 ESSTFAFTLAKLVATQCHRLWL 324 >SPCC1840.05c |||phosphomannomutase |Schizosaccharomyces pombe|chr 3|||Manual Length = 587 Score = 25.4 bits (53), Expect = 8.2 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +1 Query: 100 DRVLQIVKDERKKDVPLVRFKHPEELEAILDL 195 D + ++D D P V+F +PEE E LDL Sbjct: 259 DMISVPLQDSPNPDFPTVKFPNPEE-EGALDL 289 >SPAC6F12.08c |||exocyst complex subunit Exo84|Schizosaccharomyces pombe|chr 1|||Manual Length = 578 Score = 25.4 bits (53), Expect = 8.2 Identities = 19/84 (22%), Positives = 41/84 (48%), Gaps = 1/84 (1%) Frame = +1 Query: 73 LFKMDLSFLDRV-LQIVKDERKKDVPLVRFKHPEELEAILDLDIGQEVNDDDLERCVRQV 249 L+K+ ++ ++ L V + ++D + + +H + + +L+ +D+DLE Sbjct: 268 LYKLSINHNNKTTLLAVHNSEERDYMVRQARHHQ----LQELENWSRKHDEDLEFSRELE 323 Query: 250 LHTASKQIRQRSKTSYMAALIHMD 321 HT S+Q S TS+ ++D Sbjct: 324 YHTKSEQADMCSYTSFQVLCKNLD 347 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,950,470 Number of Sequences: 5004 Number of extensions: 59588 Number of successful extensions: 178 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 174 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 177 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 335201398 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -