BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0773 (547 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 22 4.0 AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 21 7.0 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.8 bits (44), Expect = 4.0 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +1 Query: 136 GCSGLAPLPSRVGPALQCRRDRPSEFLYHT 225 G + L+PLPS V D + LYHT Sbjct: 395 GYNTLSPLPSSVHSHSTIGNDYYNSPLYHT 424 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 21.0 bits (42), Expect = 7.0 Identities = 8/32 (25%), Positives = 18/32 (56%) Frame = -3 Query: 239 YRNQRV**RNSEGRSRRHCNAGPTRDGSGASP 144 + N+R+ + + G+++ N + +GASP Sbjct: 281 FGNKRIRYKKNIGKAQEEANLYAAKKAAGASP 312 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,868 Number of Sequences: 336 Number of extensions: 2344 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13411456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -