BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0772 (676 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 25 0.50 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 22 4.7 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 25.4 bits (53), Expect = 0.50 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 659 SQNKYVIFCHIFKVHTYSGL 600 S +Y+ CH +V+T SGL Sbjct: 136 SMERYLAICHPLRVYTISGL 155 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 22.2 bits (45), Expect = 4.7 Identities = 12/34 (35%), Positives = 16/34 (47%), Gaps = 5/34 (14%) Frame = -3 Query: 650 KYVIFCHIFKVHTYSGL-----FSNLDWNQCLCI 564 +Y+ CH F HT S L F + W LC+ Sbjct: 152 RYIAICHPFISHTMSKLSRAVKFIIVIWLLALCL 185 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,199 Number of Sequences: 438 Number of extensions: 3069 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20464920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -