BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0771 (743 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 24 1.1 AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 22 6.0 AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor su... 22 6.0 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 24.2 bits (50), Expect = 1.1 Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 2/74 (2%) Frame = +3 Query: 219 VTRKGGLNYWCKSGIGEALAHVFYGQGCKIILASRRKRELERVKQDLI--SRKVCFAEST 392 +T +G ++ +S A+ YG C+I + RRK + R+K+ L R C Sbjct: 203 LTCEGCKGFFRRSITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLSVGMRPECVVPEV 262 Query: 393 TGSETRPTEKIRRE 434 + R +K ++E Sbjct: 263 QCAVKRKEKKAQKE 276 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 21.8 bits (44), Expect = 6.0 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -1 Query: 362 YQILFNSFEFSFP 324 Y LFN FEFS P Sbjct: 354 YPHLFNFFEFSVP 366 >AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor subunit protein. Length = 243 Score = 21.8 bits (44), Expect = 6.0 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +1 Query: 139 YIGVPFVVGVTMYGV-INHLLQKKRRSTL 222 Y G P VGVTMY + I+ L + K TL Sbjct: 60 YGGPPVEVGVTMYVLSISSLSEVKMDFTL 88 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,198 Number of Sequences: 336 Number of extensions: 4486 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19819879 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -