BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0769 (499 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. 29 0.067 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 29 0.12 AY062206-1|AAL58567.1| 193|Anopheles gambiae cytochrome P450 CY... 26 0.82 AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 24 2.5 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 24 2.5 AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide recepto... 23 7.6 >EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 29.5 bits (63), Expect = 0.067 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 2/65 (3%) Frame = +1 Query: 262 QLKHTETQEKNPLPDKDVVAAEKAHQNLLDGV--EHFDKTQMKHTTTEEKNPLPPIEVIE 435 Q K T Q+K L D+ V +AH L DG + + +++H T EE++PL P+ I Sbjct: 382 QAKITLEQKKKAL-DEQVSNGRRAHAEL-DGTLQQAVGQIELQHAT-EEQSPLQPLRAIV 438 Query: 436 AEKEK 450 E+ Sbjct: 439 KRYEE 443 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 28.7 bits (61), Expect = 0.12 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 2/65 (3%) Frame = +1 Query: 262 QLKHTETQEKNPLPDKDVVAAEKAHQNLLDGV--EHFDKTQMKHTTTEEKNPLPPIEVIE 435 Q K T Q+K L D+ V +AH L DG + + ++ H T EE++PL P+ I Sbjct: 367 QAKITLEQKKKAL-DEQVSNGRRAHAEL-DGTLQQAVGQIELPHAT-EEQSPLQPLRAIV 423 Query: 436 AEKEK 450 E+ Sbjct: 424 KRYEE 428 >AY062206-1|AAL58567.1| 193|Anopheles gambiae cytochrome P450 CYP4H24 protein. Length = 193 Score = 25.8 bits (54), Expect = 0.82 Identities = 20/69 (28%), Positives = 30/69 (43%), Gaps = 1/69 (1%) Frame = +1 Query: 268 KHTETQEKNPLPDKDVVAAEKAHQNL-LDGVEHFDKTQMKHTTTEEKNPLPPIEVIEAEK 444 KH E QEK +DV+ E H L + +++F M E LPP+ I Sbjct: 17 KHPEIQEKLYREIQDVLGGEYRHVPLTYNTLQNFPYLDM--VVKESLRLLPPVSFIGRRL 74 Query: 445 EKNKFLNGI 471 + +NG+ Sbjct: 75 ADDIEMNGV 83 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 24.2 bits (50), Expect = 2.5 Identities = 22/69 (31%), Positives = 25/69 (36%), Gaps = 2/69 (2%) Frame = +3 Query: 261 PAEAHRDSGEEPASGQRCCRSGESPPEPLGRS*TLRQDSDEAHDDGRKESTAP--DRSYR 434 PA D+ G+ G S G + D DE H GRK AP R Sbjct: 616 PAGYREDTTGSYKYGKLSSSGGASSTTHSGAPSRSQSDEDEQHSVGRK-GLAPLIQRGEG 674 Query: 435 SGEGKEQIP 461 S EGK P Sbjct: 675 SFEGKAMPP 683 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 24.2 bits (50), Expect = 2.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 194 QTEAQSFHWCRRHGD 150 QT +Q+ HW + HGD Sbjct: 222 QTLSQANHWLKSHGD 236 >AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide receptor protein. Length = 493 Score = 22.6 bits (46), Expect = 7.6 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -2 Query: 378 LSLVEVFNSVQEVLVGFLRCDNI 310 LS ++ +S+ +L+G RCD + Sbjct: 108 LSRPQMRSSINYLLIGLARCDTV 130 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 508,863 Number of Sequences: 2352 Number of extensions: 10658 Number of successful extensions: 27 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44400195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -