BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0762 (725 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45705| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 8e-10 SB_54187| Best HMM Match : Globin (HMM E-Value=8.6e-30) 36 0.044 SB_1305| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.8e-11) 33 0.18 SB_49250| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_50891| Best HMM Match : CsbD (HMM E-Value=3.4) 32 0.41 SB_24813| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.95 SB_35536| Best HMM Match : zf-C2H2 (HMM E-Value=0.0069) 31 1.3 SB_46160| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_12264| Best HMM Match : Filament (HMM E-Value=0.0075) 30 1.7 SB_21059| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_24| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_56902| Best HMM Match : NACHT (HMM E-Value=1.5e-10) 30 2.2 SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_5252| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_34480| Best HMM Match : DUF988 (HMM E-Value=3.4) 29 2.9 SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) 29 2.9 SB_29515| Best HMM Match : TolA (HMM E-Value=0.031) 29 2.9 SB_17681| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_5962| Best HMM Match : EGF (HMM E-Value=8.5e-09) 29 3.8 SB_43126| Best HMM Match : Myosin_head (HMM E-Value=4.1e-32) 29 5.1 SB_31445| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_44917| Best HMM Match : DUF156 (HMM E-Value=3) 28 8.9 SB_34393| Best HMM Match : RVT_1 (HMM E-Value=2e-36) 28 8.9 SB_32523| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17) 28 8.9 SB_12729| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.3e-08) 28 8.9 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 28 8.9 SB_6206| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 >SB_45705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 449 Score = 61.3 bits (142), Expect = 8e-10 Identities = 25/55 (45%), Positives = 39/55 (70%) Frame = +1 Query: 91 MAEQVNQRIENMINELEQMRRTNLYTDEEIKEISQKRKEFEYHIQRRVKQKEDYV 255 MAE V +E M+ ELE+M R ++T EI+ I +KR +FEY +Q+R+ QK+D++ Sbjct: 1 MAENVQHNLEGMLPELEEMERLGIFTRTEIRSIIRKRTDFEYRLQKRIVQKQDFL 55 >SB_54187| Best HMM Match : Globin (HMM E-Value=8.6e-30) Length = 255 Score = 35.5 bits (78), Expect = 0.044 Identities = 21/72 (29%), Positives = 36/72 (50%) Frame = +2 Query: 443 GCGVSTGYLRYHRTNVADTW**PQMWLMASKWESLEQNNLENAKAFLLKGIQRNPDAEPL 622 GCG ST + R V Q +L+ WE++EQ++ K L+ + NPD + L Sbjct: 91 GCGSST--FKPPREPVKIPLSVAQKYLVRETWETIEQHSKAVGKKTFLRFFEMNPDYQKL 148 Query: 623 YLELFNIELIDL 658 + E ++ ++L Sbjct: 149 FPEFATLDQVEL 160 >SB_1305| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.8e-11) Length = 1491 Score = 33.5 bits (73), Expect = 0.18 Identities = 12/53 (22%), Positives = 32/53 (60%) Frame = +1 Query: 88 KMAEQVNQRIENMINELEQMRRTNLYTDEEIKEISQKRKEFEYHIQRRVKQKE 246 K E++ + + + + + ++++ N Y +EIK+ + KRKE E + + ++++ Sbjct: 596 KKQEKIIKENDELNDRINELKKENDYLAKEIKDFANKRKEMETSYEEKERERQ 648 >SB_49250| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 638 Score = 33.5 bits (73), Expect = 0.18 Identities = 19/84 (22%), Positives = 46/84 (54%) Frame = +1 Query: 88 KMAEQVNQRIENMINELEQMRRTNLYTDEEIKEISQKRKEFEYHIQRRVKQKEDYVNTSL 267 K E++N+ E + E E++ +T ++E K +++K++ +++R+ ++++ +N + Sbjct: 528 KERERLNKEKERLNKETERLDKTRERLNKERKRLNKKKERLN-KVRKRLNKEKERLNKEM 586 Query: 268 MNLPYLRI*QRVEKKYN*QRRKRI 339 L R E+K + RKR+ Sbjct: 587 ERLDKTRERLNKERKRLNKERKRL 610 Score = 32.3 bits (70), Expect = 0.41 Identities = 16/53 (30%), Positives = 30/53 (56%) Frame = +1 Query: 88 KMAEQVNQRIENMINELEQMRRTNLYTDEEIKEISQKRKEFEYHIQRRVKQKE 246 K E+VN++ E + E EQ+ + ++E K ++++RK +R K+KE Sbjct: 486 KERERVNKKKERLNKEKEQLNKEKEQLNKERKRLNKERKRVNKERERLNKEKE 538 Score = 31.1 bits (67), Expect = 0.95 Identities = 14/53 (26%), Positives = 32/53 (60%) Frame = +1 Query: 88 KMAEQVNQRIENMINELEQMRRTNLYTDEEIKEISQKRKEFEYHIQRRVKQKE 246 K+ +++N+ E + E+E++ +T ++E K ++++RK +R K+KE Sbjct: 570 KVRKRLNKEKERLNKEMERLDKTRERLNKERKRLNKERKRLNKERKRLNKEKE 622 >SB_50891| Best HMM Match : CsbD (HMM E-Value=3.4) Length = 311 Score = 32.3 bits (70), Expect = 0.41 Identities = 16/53 (30%), Positives = 30/53 (56%) Frame = +1 Query: 88 KMAEQVNQRIENMINELEQMRRTNLYTDEEIKEISQKRKEFEYHIQRRVKQKE 246 K E+VN++ E + E EQ+ + ++E K ++++RK +R K+KE Sbjct: 227 KERERVNKKKERLNKEKEQLNKEKEQLNKERKRLNKERKRVNKERERLNKEKE 279 >SB_24813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1218 Score = 31.1 bits (67), Expect = 0.95 Identities = 12/50 (24%), Positives = 27/50 (54%) Frame = +1 Query: 97 EQVNQRIENMINELEQMRRTNLYTDEEIKEISQKRKEFEYHIQRRVKQKE 246 +Q+ + I N +++ ++ + EIKE+ Q++ E H+ + +KE Sbjct: 500 QQLEEEILNQTHQITKLTEQVTGLETEIKEVRQQKDEINVHLSLSIAEKE 549 >SB_35536| Best HMM Match : zf-C2H2 (HMM E-Value=0.0069) Length = 657 Score = 30.7 bits (66), Expect = 1.3 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 4/43 (9%) Frame = +1 Query: 109 QRIENMINELE-QMRRTNLYT---DEEIKEISQKRKEFEYHIQ 225 Q IE M NELE + +RT+ DE +E+ +KE +YH Q Sbjct: 145 QDIERMKNELETERKRTSQLVEERDEMARELDNAKKELQYHKQ 187 >SB_46160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1488 Score = 30.3 bits (65), Expect = 1.7 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = -2 Query: 226 FVCDIQTLFVFGIFLLSLHLYISLFF 149 F+C ++T+F +FL+ + L+I LFF Sbjct: 1199 FICTLKTVFNKWVFLVGVELHIELFF 1224 >SB_12264| Best HMM Match : Filament (HMM E-Value=0.0075) Length = 762 Score = 30.3 bits (65), Expect = 1.7 Identities = 17/63 (26%), Positives = 34/63 (53%), Gaps = 3/63 (4%) Frame = +1 Query: 85 IKMAEQVNQRI---ENMINELEQMRRTNLYTDEEIKEISQKRKEFEYHIQRRVKQKEDYV 255 + + E++N R+ EN+ +L +++ + L DEEI ++++ + E +V D V Sbjct: 228 VLLKEELNSRVSSLENVSKQLAELQSSALTKDEEISSLTKRLQVTEKKGIEQVASLNDIV 287 Query: 256 NTS 264 N S Sbjct: 288 NVS 290 >SB_21059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1024 Score = 30.3 bits (65), Expect = 1.7 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 1/65 (1%) Frame = +1 Query: 118 ENMINELEQMRRTNLYTDEEIKEISQKRKEFEYHIQRRVKQKEDYVNTSLMNLPYL-RI* 294 E I ELE ++T+ Y K+I +KRK E +++ K +Y + M + ++ + Sbjct: 202 ERYIIELENYQKTDAYKSFVKKQIERKRKNRETELRQLRKTATEYEEQNGMLMKHIENMK 261 Query: 295 QRVEK 309 Q +EK Sbjct: 262 QAIEK 266 >SB_24| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1246 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 363 LNQLFKRFIYKFQNEIEIYFEYIKFCKGVGFQQAISGI 476 L QL R Y+ E+ + Y CKG+ F AISG+ Sbjct: 1203 LGQLLPRNQYELTKELRRFRMYTHSCKGLVFLTAISGV 1240 >SB_56902| Best HMM Match : NACHT (HMM E-Value=1.5e-10) Length = 1037 Score = 29.9 bits (64), Expect = 2.2 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = -1 Query: 434 FYILKIYFNFILELINKALEKLVQTLSNGILQILFLLC*LYFFST 300 F ++ Y F+LE+I+K + L LSN + +LF LC +F T Sbjct: 290 FNSVEEYVVFLLEIISKGMLNL--DLSNPLTLVLFCLCYKEYFQT 332 >SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1967 Score = 29.9 bits (64), Expect = 2.2 Identities = 16/56 (28%), Positives = 29/56 (51%) Frame = +1 Query: 88 KMAEQVNQRIENMINELEQMRRTNLYTDEEIKEISQKRKEFEYHIQRRVKQKEDYV 255 K EQ NQ +EN+ +E + N +E +K +E +QR++K+ E+ + Sbjct: 714 KELEQTNQELENVKCSMEGKFQENQNVFQEKCAALRKEEELVNKLQRQLKESEESI 769 >SB_5252| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 541 Score = 29.9 bits (64), Expect = 2.2 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = -2 Query: 232 LSFVCDIQTLFVFGIFLLSL-HLYISLFFSFAPTHLSYSQYVDLLVQPFLFIS 77 ++++ L V+GI +L S FF + +YSQYV L PF++++ Sbjct: 175 VAYILSCIPLIVYGILTKKARNLVGSEFFRWFALFANYSQYVSSLCNPFIYMA 227 >SB_34480| Best HMM Match : DUF988 (HMM E-Value=3.4) Length = 223 Score = 29.5 bits (63), Expect = 2.9 Identities = 13/32 (40%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Frame = -2 Query: 451 PTPLQN-FIYSKYISISFWNL*IKRLKSWFKR 359 PTP+++ + +SKY+S W++ IKR K +R Sbjct: 65 PTPMKDAWCFSKYVSFCAWDVEIKRYKQEKRR 96 >SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) Length = 3489 Score = 29.5 bits (63), Expect = 2.9 Identities = 16/53 (30%), Positives = 31/53 (58%) Frame = +3 Query: 255 QYIAYELALLEDITTRRKKIQLTEKKKDLEYAIAQRLNQLFKRFIYKFQNEIE 413 Q + EL E++ ++++ +L E L+ A++L +L K+F+ K+ EIE Sbjct: 133 QQLQTELKGSEELQEKKRQGELIEFGDILKQEYAEKLVELEKQFLEKYTKEIE 185 >SB_29515| Best HMM Match : TolA (HMM E-Value=0.031) Length = 592 Score = 29.5 bits (63), Expect = 2.9 Identities = 12/41 (29%), Positives = 24/41 (58%) Frame = +1 Query: 127 INELEQMRRTNLYTDEEIKEISQKRKEFEYHIQRRVKQKED 249 + E E++ R L +EE+K ++R++ +R K+KE+ Sbjct: 359 LEEAERLERVRLEAEEEMKRREEERRKKREEAERERKRKEE 399 >SB_17681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 366 Score = 29.1 bits (62), Expect = 3.8 Identities = 17/56 (30%), Positives = 30/56 (53%) Frame = -2 Query: 232 LSFVCDIQTLFVFGIFLLSLHLYISLFFSFAPTHLSYSQYVDLLVQPFLFISLYYF 65 +S++ ++TL +F IF LSL I + + + +V ++V LF S+ YF Sbjct: 90 ISWLVVMRTLRIFRIFSLSLSFQILFRSLISSKNELFLVFVSVMVPIILFSSMIYF 145 >SB_5962| Best HMM Match : EGF (HMM E-Value=8.5e-09) Length = 260 Score = 29.1 bits (62), Expect = 3.8 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +2 Query: 518 WLMASKWESLEQNNLENAKAFLLKG 592 WL++++W +L+ NL A+ +KG Sbjct: 219 WLISARWGNLDHQNLHQARQISIKG 243 >SB_43126| Best HMM Match : Myosin_head (HMM E-Value=4.1e-32) Length = 898 Score = 28.7 bits (61), Expect = 5.1 Identities = 10/26 (38%), Positives = 21/26 (80%) Frame = -1 Query: 413 FNFILELINKALEKLVQTLSNGILQI 336 F+++++ +NKA++K V+ L+ G+L I Sbjct: 726 FDYLVQAVNKAMQKDVEELTIGVLDI 751 >SB_31445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 28.7 bits (61), Expect = 5.1 Identities = 15/57 (26%), Positives = 27/57 (47%) Frame = +1 Query: 85 IKMAEQVNQRIENMINELEQMRRTNLYTDEEIKEISQKRKEFEYHIQRRVKQKEDYV 255 I E +N E N++ ++RR TD+ I K+K F Q++ + +Y+ Sbjct: 68 ISQMEAMNMHDE--ANQIRELRRIKRLTDKVISAFEVKKKRFAMRKQKQEENVREYL 122 >SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 733 Score = 28.3 bits (60), Expect = 6.7 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 5/58 (8%) Frame = +1 Query: 88 KMAEQVNQRIENMINELEQMR----RTNLYTDE-EIKEISQKRKEFEYHIQRRVKQKE 246 K ++ +E+M+ E+EQMR + + DE ++ E+ QK E + H+Q +E Sbjct: 544 KAMDRQRAEMEDMLREMEQMRYAEAASGHHGDESQVLELQQKIIELQEHLQAVTSHEE 601 >SB_44917| Best HMM Match : DUF156 (HMM E-Value=3) Length = 1198 Score = 27.9 bits (59), Expect = 8.9 Identities = 16/68 (23%), Positives = 33/68 (48%), Gaps = 1/68 (1%) Frame = +3 Query: 231 SQTKRRLCQYIAYELALLEDITTRRKKIQLTEKKKDLEYAIAQRLNQLFKRF-IYKFQNE 407 +Q +RR ++ YEL ++I R ++ T+ + Y + N + R+ + QN Sbjct: 54 AQQRRRNYMHVRYELVATQNIIHVRYELVATQNIIHVRYELVATQNIIHVRYELVATQNI 113 Query: 408 IEIYFEYI 431 I + +E + Sbjct: 114 IHVRYELV 121 >SB_34393| Best HMM Match : RVT_1 (HMM E-Value=2e-36) Length = 1198 Score = 27.9 bits (59), Expect = 8.9 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 2/66 (3%) Frame = +1 Query: 88 KMAEQVNQRIENMINELEQMRRTNLYTDEEIKE--ISQKRKEFEYHIQRRVKQKEDYVNT 261 KM +++ RI+ L R LYT + + +++KR E + + YVNT Sbjct: 644 KMIDELPVRIQRFRMRL---RGKELYTADALSRCPLNEKRSETSCQSDHLYAEADCYVNT 700 Query: 262 SLMNLP 279 L++LP Sbjct: 701 ILLHLP 706 >SB_32523| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17) Length = 1130 Score = 27.9 bits (59), Expect = 8.9 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +3 Query: 213 ISHTKESQTKRRLCQYIAYELALLEDITTRRKKIQLT 323 +SH +E + K C A E L T RK++ +T Sbjct: 345 LSHKEEEEKKEEYCMEYALEYGFLRLSTETRKRLNIT 381 >SB_12729| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.3e-08) Length = 1183 Score = 27.9 bits (59), Expect = 8.9 Identities = 19/66 (28%), Positives = 36/66 (54%), Gaps = 5/66 (7%) Frame = +1 Query: 64 KSNIKI*IKMAEQVNQR-IENMIN----ELEQMRRTNLYTDEEIKEISQKRKEFEYHIQR 228 K N+++ +K AE+ R +ENM+ E+ +M+ EEIK + ++ EF+ + Sbjct: 197 KQNLELELKNAEKKGSRQLENMLKDHEEEVRRMKEERKDLCEEIKALREEVNEFKARVS- 255 Query: 229 RVKQKE 246 +K +E Sbjct: 256 HLKSEE 261 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 27.9 bits (59), Expect = 8.9 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +1 Query: 88 KMAEQVNQRIENMINELEQMRRTNLYTDEEIKEISQK 198 K +QV QR++N L + + N E+I+E+S++ Sbjct: 1036 KQLKQVQQRLDNTYEALRRTQDENRNLTEQIEEVSRE 1072 >SB_6206| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 27.9 bits (59), Expect = 8.9 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = +1 Query: 112 RIENMINELEQMRRTNLYTDEEIKEISQKRKEFEYHIQRRVK 237 RIE E+ + R + ++ +++KE+ Q E++ H VK Sbjct: 265 RIEETSKEVTEQRSSVSFSPKDVKEVEQWTSEYKQHPNAIVK 306 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,556,898 Number of Sequences: 59808 Number of extensions: 421835 Number of successful extensions: 1316 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 1148 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1308 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1937927537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -