BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0762 (725 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF513638-1|AAM53610.1| 210|Anopheles gambiae glutathione S-tran... 27 0.78 U89804-1|AAD03795.1| 89|Anopheles gambiae Tc1-like transposase... 25 1.8 AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 25 3.2 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 24 5.5 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 24 5.5 >AF513638-1|AAM53610.1| 210|Anopheles gambiae glutathione S-transferase D3 protein. Length = 210 Score = 26.6 bits (56), Expect = 0.78 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Frame = +2 Query: 608 DAEPLYLELFNIELIDLCFKAE--TDEEKEKLQKKADII 718 D LY ++ I++I L K E TDE+ EKL+K D++ Sbjct: 99 DIGTLYKQI--IDIIHLVVKKEQPTDEQMEKLKKAMDLL 135 >U89804-1|AAD03795.1| 89|Anopheles gambiae Tc1-like transposase protein. Length = 89 Score = 25.4 bits (53), Expect = 1.8 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +2 Query: 467 LRYHR-TNVADTW**PQM-WLMASKWESLEQNNLENAKAFLLK 589 +R HR N+ T P W M+ KW+ + N+L+ K+ + K Sbjct: 24 IRQHRYLNIIQTVILPHAEWEMSLKWQLMHDNDLKRVKSGVKK 66 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 24.6 bits (51), Expect = 3.2 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +1 Query: 133 ELEQMRRTNLYTDEEIKEISQKRKEFEYHIQRRVKQKEDYVNTSL 267 +L T+ TD E S KRKE + ++ QKE+ + T L Sbjct: 742 QLRLQSTTDNATDSE--NSSSKRKELLQRMMKKALQKENSLTTEL 784 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.8 bits (49), Expect = 5.5 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +1 Query: 433 NSVRVWGFNRLSQVSSD 483 NS++ WG NRL ++ D Sbjct: 368 NSLKQWGMNRLRMMNRD 384 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 23.8 bits (49), Expect = 5.5 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +1 Query: 433 NSVRVWGFNRLSQVSSD 483 NS++ WG NRL ++ D Sbjct: 369 NSLKQWGMNRLRMMNRD 385 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 712,062 Number of Sequences: 2352 Number of extensions: 15960 Number of successful extensions: 24 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74012934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -