BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0761 (617 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 23 1.6 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 21 6.3 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 8.3 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 23.4 bits (48), Expect = 1.6 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = -3 Query: 261 IHISRNSWS-SEPRVTSIYRPERCY*PGLPSA 169 ++ + NS+S EP +++ RPE P PSA Sbjct: 390 LYANMNSYSVPEPTISTTPRPEWARPPSTPSA 421 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 21.4 bits (43), Expect = 6.3 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 278 CSVLAKYTSPVTVGLRS 228 CS+ +KY++ T+G RS Sbjct: 1 CSIDSKYSNEDTLGARS 17 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.0 bits (42), Expect = 8.3 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +1 Query: 433 SFGIHVMGAVGRGPRCAGGREGVVP 507 SFG+H G+ AGG VP Sbjct: 253 SFGLHATGSAPSPTAGAGGLPPQVP 277 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,184 Number of Sequences: 336 Number of extensions: 2964 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15770591 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -