BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0756 (513 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8T107 Cluster: Putative uncharacterized protein Bmhig;... 35 0.95 UniRef50_Q84K15 Cluster: Putative uncharacterized protein OSJNBa... 34 1.7 UniRef50_A5C6N4 Cluster: Putative uncharacterized protein; n=1; ... 34 1.7 UniRef50_A1UGE8 Cluster: AMP-dependent synthetase and ligase; n=... 33 3.8 UniRef50_Q6A7A1 Cluster: Aminopeptidase N; n=2; Propionibacteriu... 32 6.7 UniRef50_Q1FPN0 Cluster: Putative uncharacterized protein; n=1; ... 32 8.8 >UniRef50_Q8T107 Cluster: Putative uncharacterized protein Bmhig; n=1; Bombyx mori|Rep: Putative uncharacterized protein Bmhig - Bombyx mori (Silk moth) Length = 786 Score = 35.1 bits (77), Expect = 0.95 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = +3 Query: 321 NREHLLSTYFIRNIGTHLRDLKTGASLHTNAPDVLS 428 NR LLSTYFIRN GASL+TNAPD LS Sbjct: 386 NRGRLLSTYFIRN----------GASLNTNAPDDLS 411 >UniRef50_Q84K15 Cluster: Putative uncharacterized protein OSJNBa0037J17.9; n=1; Oryza sativa (japonica cultivar-group)|Rep: Putative uncharacterized protein OSJNBa0037J17.9 - Oryza sativa subsp. japonica (Rice) Length = 190 Score = 34.3 bits (75), Expect = 1.7 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +2 Query: 329 TSVKYVFH*KYWYPSAGFKNRCITTYECTG 418 T V++VF + W+PS G RC T EC G Sbjct: 67 TDVRWVFGDEKWWPSYGGMQRCRVTLECAG 96 >UniRef50_A5C6N4 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 941 Score = 34.3 bits (75), Expect = 1.7 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +1 Query: 358 ILVPICGI*KPVHHYIRMHRTSYPLGHDDFVYTRPST--LRVRHFLAGW 498 ++ P GI HYIR ++ + H +F Y R ST +R+F AGW Sbjct: 516 LIPPGVGIPSGCRHYIRPPLSTPDVSHPEFCYRRHSTQMFHIRNFDAGW 564 >UniRef50_A1UGE8 Cluster: AMP-dependent synthetase and ligase; n=7; Actinomycetales|Rep: AMP-dependent synthetase and ligase - Mycobacterium sp. (strain KMS) Length = 539 Score = 33.1 bits (72), Expect = 3.8 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +2 Query: 434 ATTTSCIPDRVLCALDTFWLGGIL 505 A T S P R+LCA+ FW+GG+L Sbjct: 243 AVTGSAGPVRILCAMPFFWIGGLL 266 >UniRef50_Q6A7A1 Cluster: Aminopeptidase N; n=2; Propionibacterium|Rep: Aminopeptidase N - Propionibacterium acnes Length = 864 Score = 32.3 bits (70), Expect = 6.7 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = -1 Query: 468 STRSGIHEVVVA*RIRRPVHSYVVMHRFLNPADGYQY 358 +T G HE+ V + R HS +HRF++PADG Y Sbjct: 93 TTEPGTHEITVT-ALCRYSHSGEGLHRFVDPADGKVY 128 >UniRef50_Q1FPN0 Cluster: Putative uncharacterized protein; n=1; Clostridium phytofermentans ISDg|Rep: Putative uncharacterized protein - Clostridium phytofermentans ISDg Length = 384 Score = 31.9 bits (69), Expect = 8.8 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = +3 Query: 288 VTRCYSFTVEVNREHLL--STYFIRNIGTHLRDLKTGASLHTNAPDVL 425 +TR FT++V R +LL IR I TH +++K + N P VL Sbjct: 282 MTRRMQFTIDVERLYLLLIQDVDIRGIKTHYKNIKKDMKKNKNIPSVL 329 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 537,010,887 Number of Sequences: 1657284 Number of extensions: 10511210 Number of successful extensions: 22403 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 21848 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22393 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 31364627325 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -