BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0742 (779 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g10830.1 68416.m01304 hypothetical protein 29 3.5 At3g50420.1 68416.m05515 pentatricopeptide (PPR) repeat-containi... 29 4.6 At5g39770.1 68418.m04817 repair endonuclease family protein cont... 28 6.0 >At3g10830.1 68416.m01304 hypothetical protein Length = 147 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = -2 Query: 424 ITNKNFSNQIVSCDLIIVTRVLFESAPGRRCIALNVVYKT 305 +T K+F + IVS L +TR LF + C ++++KT Sbjct: 34 LTEKDFVDAIVSVSLKDLTRSLFVRFEAKACPKFDLIHKT 73 >At3g50420.1 68416.m05515 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 794 Score = 28.7 bits (61), Expect = 4.6 Identities = 12/43 (27%), Positives = 19/43 (44%) Frame = -2 Query: 427 PITNKNFSNQIVSCDLIIVTRVLFESAPGRRCIALNVVYKTRS 299 P N N + V C + R +F+ P R ++ N +Y S Sbjct: 132 PYANNNLISMYVRCGSLEQARKVFDKMPHRNVVSYNALYSAYS 174 >At5g39770.1 68418.m04817 repair endonuclease family protein contains Pfam PF02732 : ERCC4 domain; similar to MUS81 endonuclease (GI:16755674) [Mus musculus]; similar to repair endonuclease (TIGR:At5g41150) [Arabidopsis thaliana] Length = 1242 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +2 Query: 203 LHSIKESWYSVWKCPRLLVEKTPVV 277 L + K WYS W C L+EK VV Sbjct: 864 LGTSKREWYSGWSCMSKLIEKGLVV 888 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,134,888 Number of Sequences: 28952 Number of extensions: 356968 Number of successful extensions: 771 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 761 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 771 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1746037600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -