BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0741 (744 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 21 9.2 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 9.2 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 21 9.2 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 9.2 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.4 bits (43), Expect = 9.2 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = -2 Query: 731 VHPFYLFFGS*LSYLEHQRFSTESHVFGGYKPIKEYV 621 ++P Y F S + ++ + S S V G I+ Y+ Sbjct: 165 IYPNYFFDSSVIEEAQNLKMSRGSSVVTGMNNIETYI 201 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.4 bits (43), Expect = 9.2 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = -2 Query: 731 VHPFYLFFGS*LSYLEHQRFSTESHVFGGYKPIKEYV 621 ++P Y F S + ++ + S S V G I+ Y+ Sbjct: 165 IYPNYFFDSSVIEEAQNLKMSRGSSVVTGMNNIETYI 201 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.4 bits (43), Expect = 9.2 Identities = 5/6 (83%), Positives = 5/6 (83%) Frame = +2 Query: 575 CIWCCD 592 C WCCD Sbjct: 12 CCWCCD 17 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.4 bits (43), Expect = 9.2 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -3 Query: 718 ISSSVADSATLNTSDSVRNLMFSVGTNPSRN 626 + + V T+ +S S N ++ T PSRN Sbjct: 1272 VYARVIAPTTITSSQSPGNQQQTIQTQPSRN 1302 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 218,018 Number of Sequences: 438 Number of extensions: 4865 Number of successful extensions: 13 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23266665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -