BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0739 (757 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 25 0.86 AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 23 3.5 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 22 6.1 DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 22 6.1 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 21 8.0 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 24.6 bits (51), Expect = 0.86 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -1 Query: 232 IFGIIHLLIFTVQRVDFLKLIVRHLPHVGGIIRMVKHKQKNI 107 ++ H+ F DF+ LIV ++ HV R V +K NI Sbjct: 68 MYAFTHIFFFFAICCDFIALIVVNIVHVFR-KRRVNYKDSNI 108 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 22.6 bits (46), Expect = 3.5 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -1 Query: 634 NFRTEVDQLFFFRKLDLDFERLKTCNLSFYKI 539 +F +D LFFFR FE N+S + Sbjct: 214 HFVNYIDDLFFFRFEKSKFEPFLISNISLVSL 245 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 21.8 bits (44), Expect = 6.1 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = +2 Query: 452 KLSGMRLIYKRRK 490 KL GM+++ KRRK Sbjct: 366 KLCGMKIVKKRRK 378 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 21.8 bits (44), Expect = 6.1 Identities = 7/25 (28%), Positives = 14/25 (56%) Frame = -1 Query: 394 FYNYSFGVDKNKQEFWTSILKVRNI 320 +Y Y FG+ + + F+ + K + I Sbjct: 277 YYQYPFGLPEYEYSFYQEVKKPKKI 301 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 21.4 bits (43), Expect = 8.0 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +1 Query: 301 YSCNFKLYFAPLELKSKILVC 363 Y CN KL F +SK+ C Sbjct: 322 YHCNCKLGFMGRHCESKVNFC 342 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,444 Number of Sequences: 336 Number of extensions: 3500 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20234955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -