BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0738 (725 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 27 0.45 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 27 0.78 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 25 1.8 AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant r... 25 3.2 DQ974169-1|ABJ52809.1| 508|Anopheles gambiae serpin 11 protein. 24 4.2 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 24 4.2 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 24 5.5 AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 23 7.3 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 27.5 bits (58), Expect = 0.45 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +1 Query: 379 NVGGRVRKISESRSEGPALSPRSAGLSPH-RSAPAMR 486 N +RKI SR SPRS G P RS PA R Sbjct: 242 NAHASIRKIPPSRRNPRRRSPRSGGRWPSCRSPPARR 278 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 26.6 bits (56), Expect = 0.78 Identities = 17/34 (50%), Positives = 18/34 (52%) Frame = -3 Query: 558 NPCWGCLAPHAARLASERATVRQRAHRRSAAVRT 457 NPCW C +AS R TVR RRS AV T Sbjct: 18 NPCWDCT---VWSMASNR-TVRCPRTRRSEAVMT 47 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 25.4 bits (53), Expect = 1.8 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 345 TGPLRVVYVPIVLHYWHHERHLGEGGGD 262 +G L + P + H+ HH H GGG+ Sbjct: 110 SGALHLGQNPNLHHHHHHHHHGNNGGGN 137 >AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant receptor Or1 protein. Length = 417 Score = 24.6 bits (51), Expect = 3.2 Identities = 14/52 (26%), Positives = 24/52 (46%), Gaps = 5/52 (9%) Frame = -2 Query: 271 WR*LFCGTFLEKLPP-----LRRNKICSRKLTLRSIMILIFFFTECLYFRKI 131 W L C +L PP RN+ + LR + + ++ T+ LYF+ + Sbjct: 20 WLQLLCLKYLGLWPPEDTDQATRNRYIAYGWALRIMFLHLYALTQALYFKDV 71 >DQ974169-1|ABJ52809.1| 508|Anopheles gambiae serpin 11 protein. Length = 508 Score = 24.2 bits (50), Expect = 4.2 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -3 Query: 600 CGTSPRALLPADYPNPCWGCLAPHAARLA 514 C T AL P++ P PC G + RL+ Sbjct: 69 CATIRSALEPSEQPAPCNGNRCTYDTRLS 97 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 24.2 bits (50), Expect = 4.2 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 Query: 309 LHYWHHERHLGEGGGDS 259 LH+ HH H GG+S Sbjct: 159 LHHHHHHHHNAPAGGES 175 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.8 bits (49), Expect = 5.5 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -3 Query: 309 LHYWHHERHLGEG 271 LH+ HH H GEG Sbjct: 1318 LHHGHHHHHGGEG 1330 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 23.4 bits (48), Expect = 7.3 Identities = 13/38 (34%), Positives = 16/38 (42%) Frame = +2 Query: 341 PVEPQNRRRRRGSTWEAGCGKYRSHGPKARRCHHDRQG 454 PV+ Q +RR WE G GP C +QG Sbjct: 408 PVKIQIPKRRCFKCWETGHFSRDCKGPDRTDCDAVKQG 445 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 646,634 Number of Sequences: 2352 Number of extensions: 12411 Number of successful extensions: 29 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74012934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -