BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0737 (573 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 25 1.7 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 25 1.7 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 25 2.3 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 24 3.1 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 24 3.1 X93562-1|CAA63775.1| 131|Anopheles gambiae defensin protein. 23 7.1 DQ212041-1|ABB00986.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212040-1|ABB00985.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212039-1|ABB00984.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212038-1|ABB00983.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212037-1|ABB00982.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212036-1|ABB00981.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212035-1|ABB00980.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212034-1|ABB00979.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212033-1|ABB00978.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212032-1|ABB00977.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212031-1|ABB00976.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212030-1|ABB00975.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212029-1|ABB00974.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212028-1|ABB00973.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212026-1|ABB00971.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212025-1|ABB00970.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212024-1|ABB00969.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212023-1|ABB00968.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212022-1|ABB00967.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212021-1|ABB00966.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212020-1|ABB00965.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212019-1|ABB00964.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212018-1|ABB00963.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212017-1|ABB00962.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212016-1|ABB00961.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212015-1|ABB00960.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212014-1|ABB00959.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212013-1|ABB00958.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212012-1|ABB00957.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212011-1|ABB00956.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212010-1|ABB00955.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212009-1|ABB00954.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212008-1|ABB00953.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212007-1|ABB00952.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212006-1|ABB00951.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212005-1|ABB00950.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212004-1|ABB00949.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212003-1|ABB00948.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212002-1|ABB00947.1| 102|Anopheles gambiae defensin protein. 23 7.1 DQ212001-1|ABB00946.1| 102|Anopheles gambiae defensin protein. 23 7.1 AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease pr... 23 9.3 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 25.0 bits (52), Expect = 1.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 82 VLDISWSSDGLSLLACSSDGTV 147 V SWS DG L C DG V Sbjct: 110 VTHFSWSHDGRMALICYQDGFV 131 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 25.0 bits (52), Expect = 1.7 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 442 PWTDRSRRARPTGRDASRPSSYP 510 P RSR RPT SRP+S P Sbjct: 275 PARRRSRSTRPTSWPRSRPTSKP 297 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 24.6 bits (51), Expect = 2.3 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = +2 Query: 182 HHSLWRKRTHSTRRSMVKFWRTSPGRSLIELTGRVPGDPARQRET 316 +H+L RTHST R V R L + R + + ET Sbjct: 1054 YHTLTTTRTHSTERPFVAVQRAHDNAKLQTIGAREESFSSYRSET 1098 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 24.2 bits (50), Expect = 3.1 Identities = 11/40 (27%), Positives = 18/40 (45%) Frame = -2 Query: 224 IFS*NAFFSSRVSGVPISLFVNCRQATVPSELQAKRLSPS 105 +F F+ G+P S+ +NC+ P + LS S Sbjct: 479 LFGLKRSFTPGPDGIPASVLINCKDVLAPHLAKIFNLSLS 518 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 24.2 bits (50), Expect = 3.1 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +3 Query: 24 LADVAEEAAGRHTR 65 L D+ E+AAGRH+R Sbjct: 734 LNDIIEQAAGRHSR 747 >X93562-1|CAA63775.1| 131|Anopheles gambiae defensin protein. Length = 131 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 77 EETHHAALENYRAKRATCDLASGFGVGSSLC 107 >DQ212041-1|ABB00986.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212040-1|ABB00985.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212039-1|ABB00984.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212038-1|ABB00983.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212037-1|ABB00982.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212036-1|ABB00981.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212035-1|ABB00980.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212034-1|ABB00979.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212033-1|ABB00978.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212032-1|ABB00977.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212031-1|ABB00976.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212030-1|ABB00975.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212029-1|ABB00974.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212028-1|ABB00973.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212026-1|ABB00971.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212025-1|ABB00970.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212024-1|ABB00969.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212023-1|ABB00968.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212022-1|ABB00967.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212021-1|ABB00966.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212020-1|ABB00965.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212019-1|ABB00964.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212018-1|ABB00963.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212017-1|ABB00962.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212016-1|ABB00961.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212015-1|ABB00960.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212014-1|ABB00959.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212013-1|ABB00958.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212012-1|ABB00957.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212011-1|ABB00956.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212010-1|ABB00955.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212009-1|ABB00954.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212008-1|ABB00953.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212007-1|ABB00952.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212006-1|ABB00951.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212005-1|ABB00950.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212004-1|ABB00949.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212003-1|ABB00948.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212002-1|ABB00947.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >DQ212001-1|ABB00946.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 479 EETHHARLHTHSQLDANESLGSQPG-GSENC 568 EETHHA L + A L S G GS C Sbjct: 48 EETHHAALENYRAKRATCDLASGFGVGSSLC 78 >AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease protein. Length = 435 Score = 22.6 bits (46), Expect = 9.3 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 446 GPTDRDAHVRREE 484 GPT RDA VR EE Sbjct: 178 GPTARDATVRPEE 190 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 509,926 Number of Sequences: 2352 Number of extensions: 9813 Number of successful extensions: 58 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54245403 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -