BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0737 (573 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 24 1.2 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 22 3.8 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 5.0 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 21 6.6 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 8.7 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 23.8 bits (49), Expect = 1.2 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +1 Query: 130 SSDGTVACLQFTNKEIGTPLTLEEKNAFYEKIYGKVLANESG 255 S+ G+++ LQF NK+ LTL +K F + V SG Sbjct: 252 SNKGSISKLQFHNKDDDLILTLGKKE-FSHYEHQNVFVKNSG 292 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 22.2 bits (45), Expect = 3.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 257 RSLIELTGRVPGDPA 301 R L+EL ++PG PA Sbjct: 35 RHLLELAEKIPGPPA 49 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.8 bits (44), Expect = 5.0 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -2 Query: 164 VNCRQATVPSE 132 ++CRQ TVP E Sbjct: 627 ISCRQGTVPDE 637 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 21.4 bits (43), Expect = 6.6 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -3 Query: 406 DDLASGALCDFSLFG 362 D+L G CD SL G Sbjct: 404 DELVRGTKCDVSLLG 418 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -2 Query: 92 ISRTLSLNRSCMTTSGLFS 36 I RTL +NR+ + TS + S Sbjct: 160 IRRTLHMNRTSLKTSKIVS 178 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,769 Number of Sequences: 438 Number of extensions: 2977 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16504155 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -