BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0737 (573 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g44530.1 68416.m04786 transducin family protein / WD-40 repea... 77 6e-15 At5g64630.3 68418.m08123 transducin family protein / WD-40 repea... 38 0.004 At5g64630.2 68418.m08122 transducin family protein / WD-40 repea... 38 0.004 At5g64630.1 68418.m08121 transducin family protein / WD-40 repea... 38 0.004 At5g52820.1 68418.m06556 WD-40 repeat family protein / notchless... 36 0.025 At5g54520.1 68418.m06788 WD-40 repeat family protein contains 5 ... 33 0.10 At5g67320.1 68418.m08490 WD-40 repeat family protein strong simi... 31 0.72 At2g43770.1 68415.m05441 transducin family protein / WD-40 repea... 29 1.7 At2g20330.1 68415.m02374 transducin family protein / WD-40 repea... 29 1.7 At3g10572.1 68416.m01269 3-phosphoinositide-dependent protein ki... 29 2.2 At2g26060.1 68415.m03129 transducin family protein / WD-40 repea... 29 2.2 At5g57690.1 68418.m07211 diacylglycerol kinase, putative contain... 29 2.9 At5g13840.1 68418.m01618 WD-40 repeat family protein contains 6 ... 29 2.9 At4g36660.1 68417.m05202 expressed protein 28 3.8 At4g07410.1 68417.m01136 transducin family protein / WD-40 repea... 28 5.1 At3g49400.1 68416.m05400 transducin family protein / WD-40 repea... 28 5.1 At2g18730.1 68415.m02181 diacylglycerol kinase, putative contain... 27 6.7 At5g13480.1 68418.m01554 WD-40 repeat family protein similar to ... 27 8.9 At1g27470.1 68414.m03349 transducin-related / WD-40 repeat prote... 27 8.9 >At3g44530.1 68416.m04786 transducin family protein / WD-40 repeat family protein contains 6 (4 significant) WD-40 repeats (PF0400); nuclear protein HIRA, mouse, PIR:S68141 Length = 1051 Score = 77.4 bits (182), Expect = 6e-15 Identities = 36/85 (42%), Positives = 49/85 (57%) Frame = +1 Query: 7 NRALSIWQTSLKRPLVVIHDLFSDSVLDISWSSDGLSLLACSSDGTVACLQFTNKEIGTP 186 +R +++W T RPL V F SV+D+SWS DG SL ACS DGTVA + F KE+G Sbjct: 306 DRTITVWTTGSARPLFVAKHFFGQSVVDLSWSPDGYSLFACSLDGTVAMIHFDPKELGVR 365 Query: 187 LTLEEKNAFYEKIYGKVLANESGAI 261 LT E + + YG V ++ + Sbjct: 366 LTDTELDELKKSRYGDVRGRQANLV 390 >At5g64630.3 68418.m08123 transducin family protein / WD-40 repeat family protein Similar to (SP:Q13112) Chromatin assembly factor 1 subunit B (CAF-1 subunit B) (CAF-Ip60) [Homo sapiens] Length = 428 Score = 38.3 bits (85), Expect = 0.004 Identities = 17/58 (29%), Positives = 31/58 (53%) Frame = +1 Query: 22 IWQTSLKRPLVVIHDLFSDSVLDISWSSDGLSLLACSSDGTVACLQFTNKEIGTPLTL 195 I+ T P+ V+ L ++ DI+WS + L S DG ++F +KE+G +++ Sbjct: 265 IYDTECVAPIAVLAGLHYAAITDITWSPNASYLALSSQDGYCTLVEFEDKELGEAVSI 322 >At5g64630.2 68418.m08122 transducin family protein / WD-40 repeat family protein Similar to (SP:Q13112) Chromatin assembly factor 1 subunit B (CAF-1 subunit B) (CAF-Ip60) [Homo sapiens] Length = 487 Score = 38.3 bits (85), Expect = 0.004 Identities = 17/58 (29%), Positives = 31/58 (53%) Frame = +1 Query: 22 IWQTSLKRPLVVIHDLFSDSVLDISWSSDGLSLLACSSDGTVACLQFTNKEIGTPLTL 195 I+ T P+ V+ L ++ DI+WS + L S DG ++F +KE+G +++ Sbjct: 324 IYDTECVAPIAVLAGLHYAAITDITWSPNASYLALSSQDGYCTLVEFEDKELGEAVSI 381 >At5g64630.1 68418.m08121 transducin family protein / WD-40 repeat family protein Similar to (SP:Q13112) Chromatin assembly factor 1 subunit B (CAF-1 subunit B) (CAF-Ip60) [Homo sapiens] Length = 397 Score = 38.3 bits (85), Expect = 0.004 Identities = 17/58 (29%), Positives = 31/58 (53%) Frame = +1 Query: 22 IWQTSLKRPLVVIHDLFSDSVLDISWSSDGLSLLACSSDGTVACLQFTNKEIGTPLTL 195 I+ T P+ V+ L ++ DI+WS + L S DG ++F +KE+G +++ Sbjct: 324 IYDTECVAPIAVLAGLHYAAITDITWSPNASYLALSSQDGYCTLVEFEDKELGEAVSI 381 >At5g52820.1 68418.m06556 WD-40 repeat family protein / notchless protein, putative similar to notchless [Xenopus laevis] GI:3687833; contains Pfam PF00400: WD domain, G-beta repeat (8 copies) Length = 473 Score = 35.5 bits (78), Expect = 0.025 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 1/68 (1%) Frame = +1 Query: 4 GNRALSIWQTSLKRPLVVIHDLFSDSVLDISWSSDGLSLLACSSDGTVACLQFTNKEI-G 180 G+ + +W + PL + VL ++WS DG L++ S G + C E+ G Sbjct: 129 GDTTVRLWDLYTETPLFTCKG-HKNWVLTVAWSPDGKHLVSGSKSGEICCWNPKKGELEG 187 Query: 181 TPLTLEEK 204 +PLT +K Sbjct: 188 SPLTGHKK 195 >At5g54520.1 68418.m06788 WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to pre-mRNA splicing factor PRP17 (SP:O60508) [Homo sapiens] Length = 457 Score = 33.5 bits (73), Expect = 0.10 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +1 Query: 19 SIWQTSLKRPLVVIHDLFSDSVLDISWSSDGLSLLACSSDGT 144 ++W K+ +H + V D+ WS GLSLL+C D T Sbjct: 189 NVWSNDKKKVRAFLHH--NAPVKDVKWSKQGLSLLSCGYDCT 228 >At5g67320.1 68418.m08490 WD-40 repeat family protein strong similarity to unknown protein (ref|NP_005638.1) Length = 613 Score = 30.7 bits (66), Expect = 0.72 Identities = 13/52 (25%), Positives = 28/52 (53%) Frame = +1 Query: 7 NRALSIWQTSLKRPLVVIHDLFSDSVLDISWSSDGLSLLACSSDGTVACLQF 162 ++++ IW S+K +V + + ++ W+ +G + AC +D +V L F Sbjct: 562 DKSIHIW--SIKEGKIVKTYTGNGGIFEVCWNKEGNKIAACFADNSVCVLDF 611 >At2g43770.1 68415.m05441 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to U5 snRNP-specific 40 kDa protein (GI:3820594) [Homo sapiens] Length = 343 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/35 (37%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +1 Query: 76 DSVLDISWSSDGLSLLACSSDGTVACLQF-TNKEI 177 +++LD+ W+SDG +++ S D TV T K+I Sbjct: 97 NAILDLHWTSDGSQIVSASPDKTVRAWDVETGKQI 131 >At2g20330.1 68415.m02374 transducin family protein / WD-40 repeat family protein similar to Transcriptional repressor rco-1 (SP:P78706) [Neurospora crassa]; similar to TUP1(GB:AF079369); contains 6 WD-40 repeats (PF00400) Length = 648 Score = 29.5 bits (63), Expect = 1.7 Identities = 15/51 (29%), Positives = 27/51 (52%), Gaps = 3/51 (5%) Frame = +1 Query: 4 GNRALSIWQTSL---KRPLVVIHDLFSDSVLDISWSSDGLSLLACSSDGTV 147 G+ ++ IW RP + + +D + + +SSDG LL+ S DG++ Sbjct: 347 GDGSIQIWSLKPGWGSRPDIYVGKAHTDDITSVKFSSDGRILLSRSFDGSL 397 >At3g10572.1 68416.m01269 3-phosphoinositide-dependent protein kinase-1, putative annotation temporarily based on supporting cDNA gi|17065215|gb|AY062684.1| Length = 333 Score = 29.1 bits (62), Expect = 2.2 Identities = 10/32 (31%), Positives = 22/32 (68%) Frame = +2 Query: 149 LAYSLRTKKSVHHSLWRKRTHSTRRSMVKFWR 244 + Y+L+ K++ + R++ STR+++V FW+ Sbjct: 281 ICYALKRKRAALIRIIRRQMESTRKAIVDFWK 312 >At2g26060.1 68415.m03129 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to WD40-repeat containing protein Ciao 1 (SP:O76071) [Homo sapiens] Length = 352 Score = 29.1 bits (62), Expect = 2.2 Identities = 21/69 (30%), Positives = 30/69 (43%), Gaps = 4/69 (5%) Frame = +1 Query: 4 GNRALSIW-QTSLKRPLV---VIHDLFSDSVLDISWSSDGLSLLACSSDGTVACLQFTNK 171 G+ + IW Q+SL R V+ + + +V +WS G L S DGT + Sbjct: 47 GDNTVRIWEQSSLSRSWTCKTVLEETHTRTVRSCAWSPSGQLLATASFDGTTGIWKNYGS 106 Query: 172 EIGTPLTLE 198 E TLE Sbjct: 107 EFECISTLE 115 >At5g57690.1 68418.m07211 diacylglycerol kinase, putative contains INTERPRO domain, IPR001206, DAG-kinase catalytic domain Length = 498 Score = 28.7 bits (61), Expect = 2.9 Identities = 15/49 (30%), Positives = 19/49 (38%) Frame = +3 Query: 84 PGYILELRWAQPFSL*FGWNGRLPTVYEQRNRYTTHSGGKERILREDLW 230 P I+ L S FGW G P ++ + T H I R D W Sbjct: 188 PVSIMPLGTGNDLSRSFGWGGSFPFAWKSAIKRTLHRASVAPISRLDSW 236 >At5g13840.1 68418.m01618 WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to Fzr1 (GI:6463679){Homo sapiens} Length = 481 Score = 28.7 bits (61), Expect = 2.9 Identities = 16/58 (27%), Positives = 28/58 (48%) Frame = +1 Query: 16 LSIWQTSLKRPLVVIHDLFSDSVLDISWSSDGLSLLACSSDGTVACLQFTNKEIGTPL 189 L +W ++P++ + + + +V I+WS SLLA C++F N G L Sbjct: 322 LLVWNNHSQQPILKLTE-HTAAVKAITWSPHQSSLLASGGGTADRCIRFWNTTNGNQL 378 >At4g36660.1 68417.m05202 expressed protein Length = 159 Score = 28.3 bits (60), Expect = 3.8 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +2 Query: 170 KKSVHHSLWRKRTHSTRRSMVKFWRTSPGRSLIELTGRVPG 292 +K V H +W T+S R + +FW+ + + ELT VPG Sbjct: 93 EKVVKH-MWDVYTNSRRIKLPRFWQEAFVAAYEELTSDVPG 132 >At4g07410.1 68417.m01136 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400) (2 weak); similar to Vegetatible incompatibility protein HET-E-1 (SP:Q00808) {Podospora anserina} Length = 815 Score = 27.9 bits (59), Expect = 5.1 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 73 SDSVLDISWSSDGLSLLACSSDGTVACLQFTN 168 S L ++WS D + + SSDG + C T+ Sbjct: 198 SGRALSVTWSPDAKRIFSGSSDGLIRCWDATS 229 >At3g49400.1 68416.m05400 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); low similarity (47%) to Agamous-like MADS box protein AGL5 (SP:P29385) {Arabidopsis thaliana} Length = 892 Score = 27.9 bits (59), Expect = 5.1 Identities = 14/51 (27%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = +1 Query: 4 GNRALSIWQTSL---KRPLVVIHDLFSDSVLDISWSSDGLSLLACSSDGTV 147 G+ + +W+ + K +V + + V ++WS DG L +CS D V Sbjct: 410 GSGSFEVWKCEISTRKFEQIVSTNAHNQVVTGLAWSYDGRCLYSCSQDNYV 460 >At2g18730.1 68415.m02181 diacylglycerol kinase, putative contains INTERPRO domain, IPR001206, DAG-kinase catalytic domain Length = 488 Score = 27.5 bits (58), Expect = 6.7 Identities = 13/49 (26%), Positives = 18/49 (36%) Frame = +3 Query: 84 PGYILELRWAQPFSL*FGWNGRLPTVYEQRNRYTTHSGGKERILREDLW 230 P ++ L S FGW G P + + T H + R D W Sbjct: 189 PVGVIPLGTGNDLSRSFGWGGSFPFAWRSAVKRTLHRASMGPVARLDSW 237 >At5g13480.1 68418.m01554 WD-40 repeat family protein similar to WD-repeat protein WDC146 (SP:Q9C0J8|) {Homo sapiens}; contains 3 weak Pfam PF00400: WD domain, G-beta repeats; Length = 711 Score = 27.1 bits (57), Expect = 8.9 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = +1 Query: 16 LSIWQTSLKRPLVVIHDLFSDSVLDISWSSDGLSLLACSSDGTVACLQFT 165 L WQ ++ + +S+ D+S+ L +CS D TV FT Sbjct: 189 LKYWQNNMNN-VKANKTAHKESIRDLSFCKTDLKFCSCSDDTTVKVWDFT 237 >At1g27470.1 68414.m03349 transducin-related / WD-40 repeat protein-related contains 6 WD-40 repeats (PF00400) (2 weak); related to KIAA1988 protein (GI:18916910) [Homo sapiens] Length = 810 Score = 27.1 bits (57), Expect = 8.9 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +1 Query: 85 LDISWSSDGLSLLACSSDGTVAC 153 L ++WS+D + + SSDG + C Sbjct: 202 LSVTWSADAQRIFSGSSDGLIRC 224 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,804,634 Number of Sequences: 28952 Number of extensions: 199427 Number of successful extensions: 729 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 710 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 729 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1112061928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -