BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0728 (777 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 24 1.4 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 22 5.5 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 5.5 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 5.5 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 24.2 bits (50), Expect = 1.4 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +3 Query: 270 HHFQECPQHEGDEIQCITSRACRC 341 HH P+ G +++ I AC C Sbjct: 464 HHHPHPPETPGPQVETILQNACFC 487 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 22.2 bits (45), Expect = 5.5 Identities = 11/45 (24%), Positives = 22/45 (48%) Frame = +3 Query: 603 NKHNRLFMKAQPMPDGLPEDIDEGRVNPRDDFKTRARYLTEKYEY 737 N H +F+ +PD +P D+ R+ +D +Y ++ Y + Sbjct: 558 NSHESVFV----VPDEVPSDVLYNRLVVSEDGSETFKYSSQPYGF 598 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 22.2 bits (45), Expect = 5.5 Identities = 11/45 (24%), Positives = 22/45 (48%) Frame = +3 Query: 603 NKHNRLFMKAQPMPDGLPEDIDEGRVNPRDDFKTRARYLTEKYEY 737 N H +F+ +PD +P D+ R+ +D +Y ++ Y + Sbjct: 558 NSHESVFV----VPDEVPSDVLYNRLVVSEDGSETFKYSSQPYGF 598 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 22.2 bits (45), Expect = 5.5 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +1 Query: 91 KSSHHGTKLYTWKERGLV*EDYPAYNPYDGTL 186 +S H+ +L W+ +V DY Y+ D L Sbjct: 272 ESDHNDGRLRYWRTPSVVVSDYSDYSYLDEKL 303 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 225,178 Number of Sequences: 438 Number of extensions: 4737 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24396777 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -