BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0727 (783 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 24 4.6 AF117752-1|AAD38338.1| 155|Anopheles gambiae serine protease 2A... 23 8.1 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 24.2 bits (50), Expect = 4.6 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = -2 Query: 545 TWAPGNAGSNRSFKLCVHECVHDIV 471 TW G+A + + L V +C H ++ Sbjct: 47 TWKEGDAKARATIALLVDDCQHPLI 71 >AF117752-1|AAD38338.1| 155|Anopheles gambiae serine protease 2A protein. Length = 155 Score = 23.4 bits (48), Expect = 8.1 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +3 Query: 387 DAACMTL-SNITRLEDELEVCLNTFIPHLNDIMNAFV 494 D A + L +N+T +D +CLNT P + +N V Sbjct: 49 DIALIELKNNVTYKQDVGPICLNTDRPEIGPSINLTV 85 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 828,500 Number of Sequences: 2352 Number of extensions: 17495 Number of successful extensions: 39 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81913191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -