BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0727 (783 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 25 0.79 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 23 2.4 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 5.6 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 22 5.6 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 25.0 bits (52), Expect = 0.79 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = -2 Query: 668 HHPSVCWTHHSYRTVLILLTVHGDSLRRATSLF 570 HH S WT L L H SL +A++ F Sbjct: 405 HHGSKSWTQEDMDAALEALRNHDMSLTKASATF 437 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 23.4 bits (48), Expect = 2.4 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +2 Query: 137 ISSAYRGRKTVLTKCLNTKESLKPSSN*RTTESKKSLNT 253 +++ YR +KTV K +N+K LK + + + NT Sbjct: 315 VNTIYRRKKTVPLKKVNSKYILKSTLTPKLARKQFQKNT 353 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 22.2 bits (45), Expect = 5.6 Identities = 8/29 (27%), Positives = 14/29 (48%) Frame = +2 Query: 122 TYPWTISSAYRGRKTVLTKCLNTKESLKP 208 T+P Y+GR V+ C+ + +P Sbjct: 83 TFPTIKIVGYKGRALVVVSCVTKDQPYRP 111 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 22.2 bits (45), Expect = 5.6 Identities = 8/29 (27%), Positives = 14/29 (48%) Frame = +2 Query: 122 TYPWTISSAYRGRKTVLTKCLNTKESLKP 208 T+P Y+GR V+ C+ + +P Sbjct: 83 TFPTIKIVGYKGRALVVVSCVTKDQPYRP 111 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 217,086 Number of Sequences: 438 Number of extensions: 4566 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24639531 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -