BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0726 (625 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 25 0.68 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 22 4.8 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 24.6 bits (51), Expect = 0.68 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +1 Query: 517 STPRSEASSRISVCPSLSTWVRTPSRCWTTRCTSGS 624 STP ++ S + P WV S T R T+ S Sbjct: 417 STPSADGSKPVQTTPKPGQWVPEKSTSTTQRTTTVS 452 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 21.8 bits (44), Expect = 4.8 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = -1 Query: 517 SASCPQGCPSRMRPSRQDPEYVLRRLQQWRGRPSPASS 404 SAS P++++ S+ P R + G P+P++S Sbjct: 193 SASRTTTSPTKVKASKASPAAAPRSVATPTGIPTPSTS 230 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,905 Number of Sequences: 336 Number of extensions: 3813 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15979473 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -