BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0726 (625 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 25 1.5 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 25 2.6 AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 24 3.4 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 25.4 bits (53), Expect = 1.5 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = +1 Query: 511 SRSTPRSEASSRISVC--PSLSTWVRTPS-RCWTTRCTSGS 624 +RSTP S ++ S C P S W R S RC R S S Sbjct: 47 TRSTPSSPRLAQASTCPVPCSSIWSRPSSMRCAPARTASCS 87 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 24.6 bits (51), Expect = 2.6 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -1 Query: 541 LMPPSAV*SASCPQGCPSRMRPSRQDPEYV 452 ++P S + +A+ G PS M P +P YV Sbjct: 3224 VVPGSGLPAAAASGGAPSAMPPIVNEPPYV 3253 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -1 Query: 502 QGCPSRMRPSRQDPEYVLRRLQQWR 428 +G P M S + E VLR L+ WR Sbjct: 319 EGYPIYMNNSVKQDEEVLRELEPWR 343 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 735,171 Number of Sequences: 2352 Number of extensions: 16728 Number of successful extensions: 54 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 54 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 54 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60632475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -