BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0725 (675 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 26 1.3 AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific do... 25 1.7 AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doub... 25 1.7 DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific do... 25 2.2 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 25 2.2 AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. 25 2.9 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 24 3.8 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 25.8 bits (54), Expect = 1.3 Identities = 17/60 (28%), Positives = 23/60 (38%), Gaps = 3/60 (5%) Frame = +3 Query: 312 RPATKSRPYNGSTTESPRHRSHET*ACQSPLCAAGARTRTNC---AT*RHDYRHPTRTRA 482 RP+T + + P+H S+ T P T +NC T H H RT A Sbjct: 1236 RPSTLGPSVASTRLDGPQHHSYATIGPNCPRNCDNYDTVSNCKYNTTQHHQTHHERRTTA 1295 >AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific doublesex protein protein. Length = 241 Score = 25.4 bits (53), Expect = 1.7 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +3 Query: 69 GASRYARLRSVTCERICEISDTCRALRIHT 158 G RY + R+ CE+ C ++ R + + T Sbjct: 55 GHKRYCKYRACQCEKCCLTAERQRVMALQT 84 >AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doublesex protein protein. Length = 283 Score = 25.4 bits (53), Expect = 1.7 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +3 Query: 69 GASRYARLRSVTCERICEISDTCRALRIHT 158 G RY + R+ CE+ C ++ R + + T Sbjct: 55 GHKRYCKYRACQCEKCCLTAERQRVMALQT 84 >DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific doublesex protein protein. Length = 265 Score = 25.0 bits (52), Expect = 2.2 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +3 Query: 69 GASRYARLRSVTCERICEISDTCRALRIHT 158 G RY + R+ CE+ C ++ R + + T Sbjct: 55 GHKRYCKYRTCHCEKCCLTAERQRVMALQT 84 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 25.0 bits (52), Expect = 2.2 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +3 Query: 69 GASRYARLRSVTCERICEISDTCRALRIHT 158 G RY + R+ CE+ C ++ R + + T Sbjct: 55 GHKRYCKYRTCHCEKCCLTAERQRVMALQT 84 >AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. Length = 461 Score = 24.6 bits (51), Expect = 2.9 Identities = 13/41 (31%), Positives = 17/41 (41%) Frame = +2 Query: 161 IFIGWDSSIQRTLIKAITTALSKIVNKTHAGCNKRVAIMAT 283 + I W S+ + AI T S T A C +MAT Sbjct: 298 VHIAWQFSVTVARVLAIATVASVFPLYTAAACAVHALLMAT 338 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 24.2 bits (50), Expect = 3.8 Identities = 11/30 (36%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +3 Query: 330 RPYNGSTTESPRHRSHET*AC-QSPLCAAG 416 R YNG SP H+ C + P C+ G Sbjct: 2469 RSYNGPFRNSPEHKGSSQRNCSRGPPCSPG 2498 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 644,741 Number of Sequences: 2352 Number of extensions: 12125 Number of successful extensions: 44 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67741110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -