BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0719 (798 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U10414-10|AAA19077.1| 176|Caenorhabditis elegans Hypothetical p... 30 1.7 Z81043-8|CAB02804.2| 550|Caenorhabditis elegans Hypothetical pr... 29 3.9 U61237-1|AAB17542.1| 550|Caenorhabditis elegans M89 protein. 29 3.9 AL023813-2|CAA19424.2| 550|Caenorhabditis elegans Hypothetical ... 29 3.9 Z79756-6|CAB02117.3| 693|Caenorhabditis elegans Hypothetical pr... 28 6.7 AC025726-25|AAK73927.2| 409|Caenorhabditis elegans Hypothetical... 28 8.9 >U10414-10|AAA19077.1| 176|Caenorhabditis elegans Hypothetical protein F42A10.6 protein. Length = 176 Score = 30.3 bits (65), Expect = 1.7 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 150 WSWHLRVRAWLSTTTVTMQMRISACSSPVP 239 WSW++ W S T + I AC++ VP Sbjct: 88 WSWNMATCGWSSVPTFGLLNNIDACTNGVP 117 >Z81043-8|CAB02804.2| 550|Caenorhabditis elegans Hypothetical protein C29F3.2 protein. Length = 550 Score = 29.1 bits (62), Expect = 3.9 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +3 Query: 279 LHNADSFTQTDRHLLFAGRC 338 L N +SFT T++HL+FA C Sbjct: 400 LENGESFTLTEKHLVFATDC 419 >U61237-1|AAB17542.1| 550|Caenorhabditis elegans M89 protein. Length = 550 Score = 29.1 bits (62), Expect = 3.9 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +3 Query: 279 LHNADSFTQTDRHLLFAGRC 338 L N +SFT T++HL+FA C Sbjct: 400 LENGESFTLTEKHLVFATDC 419 >AL023813-2|CAA19424.2| 550|Caenorhabditis elegans Hypothetical protein C29F3.2 protein. Length = 550 Score = 29.1 bits (62), Expect = 3.9 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +3 Query: 279 LHNADSFTQTDRHLLFAGRC 338 L N +SFT T++HL+FA C Sbjct: 400 LENGESFTLTEKHLVFATDC 419 >Z79756-6|CAB02117.3| 693|Caenorhabditis elegans Hypothetical protein F53C11.2 protein. Length = 693 Score = 28.3 bits (60), Expect = 6.7 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +1 Query: 244 RVPHIFAGAAAGYIMQTPSHKRIDIFYSLVGVALFVASGAII 369 RVP F G GY + T + R+ +S+ VASG + Sbjct: 507 RVPSFFIGIFVGYFLATFTKTRLKFHWSVTIFGWVVASGIAV 548 >AC025726-25|AAK73927.2| 409|Caenorhabditis elegans Hypothetical protein Y71G12B.26 protein. Length = 409 Score = 27.9 bits (59), Expect = 8.9 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -2 Query: 455 IAPLMMANEALAKFLSLISLLP*CWN 378 + P + ++AL FL++++LLP WN Sbjct: 163 VTPSLEISQALCGFLAILTLLPVIWN 188 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,884,859 Number of Sequences: 27780 Number of extensions: 376384 Number of successful extensions: 979 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 951 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 979 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1945792630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -