BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0719 (798 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 24 1.4 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 24.2 bits (50), Expect = 1.4 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +1 Query: 361 AIIIDRFQHYGKSEIKDKNLAKASLAIINGAILLVDAVLTQRG 489 A+ I + H + + + K LAK + +G ++ V+ +L Q+G Sbjct: 1095 AVQIQQSPHQQQQQQQQKILAKVLTSSNSGQLISVENLLAQKG 1137 Score = 22.6 bits (46), Expect = 4.3 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +3 Query: 180 LSTTTVTMQMRISACSSPVPLSGTSHI 260 LST T T + ++ + VPL+ +S++ Sbjct: 512 LSTATSTCSLAVAKQQNQVPLTSSSNV 538 Score = 21.8 bits (44), Expect = 7.6 Identities = 7/15 (46%), Positives = 13/15 (86%) Frame = -1 Query: 243 TKVPVTSMPISASAL 199 T VP+TS+P S++++ Sbjct: 852 TTVPITSLPASSTSI 866 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 215,819 Number of Sequences: 438 Number of extensions: 4836 Number of successful extensions: 16 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25246416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -