BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0716 (774 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 23 2.7 AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory recept... 23 3.6 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 104 EVTQILYSNIQKLLPTQESRDLAE 175 EV Q+ +QK L T+E +DL + Sbjct: 19 EVAQVWEQTLQKGLDTEEIKDLLQ 42 >AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory receptor candidate 24 protein. Length = 384 Score = 22.6 bits (46), Expect = 3.6 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +1 Query: 280 VQFLRTQLNEFGIINTTPDFANFFAAPSSIK 372 ++ L Q FG++ TPD + F PSS++ Sbjct: 15 IRILLFQSRIFGLVTFTPDRSKF--RPSSLR 43 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,307 Number of Sequences: 336 Number of extensions: 3378 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20857569 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -