BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0716 (774 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g51760.1 68418.m06418 protein phosphatase 2C, putative / PP2C... 28 6.0 At4g17330.1 68417.m02600 agenet domain-containing protein contai... 28 6.0 At1g22530.1 68414.m02814 SEC14 cytosolic factor family protein /... 28 6.0 At5g14520.1 68418.m01702 pescadillo-related similar to pescadill... 28 7.9 At4g14330.1 68417.m02207 phragmoplast-associated kinesin-related... 28 7.9 >At5g51760.1 68418.m06418 protein phosphatase 2C, putative / PP2C, putative contains PF00481: Protein phosphatase 2C domain; similar to protein phosphatase 2C (GI:10432446) [Nicotiana tabacum] Length = 416 Score = 28.3 bits (60), Expect = 6.0 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +1 Query: 697 IERKWTGYSKRSFQRIPD 750 +ERKW G KRSF+R+ + Sbjct: 188 VERKWRGVMKRSFKRMDE 205 >At4g17330.1 68417.m02600 agenet domain-containing protein contains Pfam PF05641: Agenet domain Length = 1058 Score = 28.3 bits (60), Expect = 6.0 Identities = 9/28 (32%), Positives = 21/28 (75%) Frame = -1 Query: 486 VDATRSVGSEKGQDVREITGVQLFEEAP 403 +DA +++ + K +D++E + V++F+E P Sbjct: 580 IDAQQTIKATKNEDIKEGSNVEVFKEEP 607 >At1g22530.1 68414.m02814 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein contains Pfam PF00650 : CRAL/TRIO domain; contains Pfam PF03765 : CRAL/TRIO, N-terminus; similar to SEC14-like protein 2 (Alpha-tocopherol associated protein) (TAP) (bTAP) (Fragment) (SP:P58875) {Bos taurus} Length = 683 Score = 28.3 bits (60), Expect = 6.0 Identities = 19/74 (25%), Positives = 36/74 (48%), Gaps = 7/74 (9%) Frame = +1 Query: 253 ELITAVTSLVQFL--RTQLNEFGI--INTTPDFANFFAAPSSIKSAPSLAGEATWSFFKQ 420 E+ + L +FL R Q E + ++ +P+ + F S ++AP L A W F K+ Sbjct: 439 EIFSDKEKLSKFLKWRIQFQEKCVRSLDFSPEAKSSFVFVSDFRNAPGLGQRALWQFIKR 498 Query: 421 L---YSGDFPDILA 453 + ++P+ +A Sbjct: 499 AVKQFEDNYPEFVA 512 >At5g14520.1 68418.m01702 pescadillo-related similar to pescadillo [Zebrafish, Danio rerio] SWISS-PROT:P79741 Length = 590 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Frame = -2 Query: 644 LKLD*QREV---SIDVVVRQYVATVSWEGEVATVEREDVLTVHN 522 LK REV S+ +V+ + VSWEGE A + +D H+ Sbjct: 340 LKFFLSREVPRESLQLVITAFGGMVSWEGEGAPFKEDDESITHH 383 >At4g14330.1 68417.m02207 phragmoplast-associated kinesin-related protein 2 (PAKRP2) identical to cDNA phragmoplast-associated kinesin-related protein 2 (PAKRP2) GI:16973450 Length = 869 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/54 (27%), Positives = 30/54 (55%) Frame = +2 Query: 86 VPEKILEVTQILYSNIQKLLPTQESRDLAEAIHSYVQKKLRNQKCDDEKELRVV 247 + EK+ E TQ+L S + K L +E R +AE ++++ + ++EL ++ Sbjct: 449 IKEKVNERTQLLKSELDKKL--EECRRMAEEFVEMERRRMEERIVQQQEELEMM 500 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,241,133 Number of Sequences: 28952 Number of extensions: 330370 Number of successful extensions: 980 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 956 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 980 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1726528800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -