BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0715 (694 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 24 4.0 AJ000034-1|CAA03870.1| 98|Anopheles gambiae 5'-nucleotidase pr... 24 4.0 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 23 9.1 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 24.2 bits (50), Expect = 4.0 Identities = 16/56 (28%), Positives = 23/56 (41%) Frame = +3 Query: 90 LSVEDLHKFLDSFDHVLSDCDGVIWTQDSLPRVGEFFKQMKKRGKTVNFVSNNSLD 257 + + DLH D + S C + RV KQ+K KT N + N+ D Sbjct: 39 IHINDLHARFDETNQKSSTCTNSKECIAGIARVYHTIKQLKSEYKTKNPLYLNAGD 94 >AJ000034-1|CAA03870.1| 98|Anopheles gambiae 5'-nucleotidase protein. Length = 98 Score = 24.2 bits (50), Expect = 4.0 Identities = 16/56 (28%), Positives = 23/56 (41%) Frame = +3 Query: 90 LSVEDLHKFLDSFDHVLSDCDGVIWTQDSLPRVGEFFKQMKKRGKTVNFVSNNSLD 257 + + DLH D + S C + RV KQ+K KT N + N+ D Sbjct: 39 IHINDLHARFDETNQKSSTCTNSKECIAGIARVYHTIKQLKSEYKTKNPLYLNAGD 94 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 23.0 bits (47), Expect = 9.1 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +2 Query: 404 KRVLEAHGFKCKEGPDLGPEYYGEYIQYLEDDEEI 508 ++VLE+ + +E D+ YYG I+ D+ I Sbjct: 513 RKVLESFLQRGREYADIANAYYGPVIENFNCDKSI 547 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 658,936 Number of Sequences: 2352 Number of extensions: 12108 Number of successful extensions: 20 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70250040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -