BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0713 (756 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69976-1|CAA93816.1| 204|Anopheles gambiae ribosomal protein RL... 124 2e-30 EF519528-1|ABP73591.1| 250|Anopheles gambiae APL2 protein. 25 2.5 EF519524-1|ABP73587.1| 250|Anopheles gambiae APL2 protein. 25 2.5 EF519520-1|ABP73583.1| 250|Anopheles gambiae APL2 protein. 25 2.5 EF519517-1|ABP73580.1| 250|Anopheles gambiae APL2 protein. 25 2.5 EF519516-1|ABP73579.1| 250|Anopheles gambiae APL2 protein. 25 2.5 EF519515-1|ABP73578.1| 250|Anopheles gambiae APL2 protein. 25 2.5 EF519514-1|ABP73577.1| 250|Anopheles gambiae APL2 protein. 25 2.5 EF519513-1|ABP73576.1| 250|Anopheles gambiae APL2 protein. 25 2.5 EF519512-1|ABP73575.1| 250|Anopheles gambiae APL2 protein. 25 2.5 EF519511-1|ABP73574.1| 250|Anopheles gambiae APL2 protein. 25 2.5 EF519510-1|ABP73573.1| 250|Anopheles gambiae APL2 protein. 25 2.5 EF519509-1|ABP73572.1| 250|Anopheles gambiae APL2 protein. 25 2.5 EF519508-1|ABP73571.1| 250|Anopheles gambiae APL2 protein. 25 2.5 EF519507-1|ABP73570.1| 250|Anopheles gambiae APL2 protein. 25 2.5 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 25 2.5 EF519526-1|ABP73589.1| 250|Anopheles gambiae APL2 protein. 25 3.3 EF519525-1|ABP73588.1| 250|Anopheles gambiae APL2 protein. 25 3.3 EF519523-1|ABP73586.1| 250|Anopheles gambiae APL2 protein. 25 3.3 EF519522-1|ABP73585.1| 250|Anopheles gambiae APL2 protein. 25 3.3 EF519521-1|ABP73584.1| 250|Anopheles gambiae APL2 protein. 25 3.3 EF519519-1|ABP73582.1| 250|Anopheles gambiae APL2 protein. 25 3.3 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 24 5.8 EF427621-5|ABO09853.1| 62|Anopheles gambiae tal-like protein A... 23 7.7 >Z69976-1|CAA93816.1| 204|Anopheles gambiae ribosomal protein RL10 protein. Length = 204 Score = 124 bits (300), Expect = 2e-30 Identities = 57/83 (68%), Positives = 65/83 (78%) Frame = -2 Query: 506 GGRKRPVAKGATYGKPKSHGVNQLKPTRNLQSIAEEXXXXXXXXXXXLSSYWVAQDSSYK 327 GGRKRPV KG TYGKPKSHGVNQLKP R LQS+AEE L+SYWVAQD+++K Sbjct: 69 GGRKRPVHKGCTYGKPKSHGVNQLKPYRCLQSVAEERVGGRLGGLRVLNSYWVAQDAAHK 128 Query: 326 YFEVILVDPSHKAIRRDPKINWI 258 YFEVI+VDP + AIRRDP +NWI Sbjct: 129 YFEVIMVDPPNNAIRRDPNVNWI 151 Score = 107 bits (257), Expect = 4e-25 Identities = 46/59 (77%), Positives = 52/59 (88%) Frame = -3 Query: 709 MGAYRYIQELYRKKLSDVMRFLLRVRVWQYRQLTRMHRAPRPTRPDKARRLGYRAKQGY 533 MGAYRY+QELYRKK SDVMR+LLRVR WQYRQ+TR HRAPRP RP + RRLGY+AK G+ Sbjct: 1 MGAYRYVQELYRKKQSDVMRYLLRVRAWQYRQMTRFHRAPRPWRPTRLRRLGYKAKTGF 59 Score = 87.0 bits (206), Expect = 6e-19 Identities = 41/52 (78%), Positives = 46/52 (88%) Frame = -1 Query: 255 DAVHKHREMRGLTSAGRSSRGLGKGHRYSQTKGGSRRAAWLRRNTLQLRRKR 100 +AVHKHRE+RGLTSAG+SSRGLGK +RYSQT GGSRRAA +RRN L LRR R Sbjct: 153 NAVHKHRELRGLTSAGKSSRGLGKAYRYSQTIGGSRRAAGVRRNRLHLRRYR 204 >EF519528-1|ABP73591.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 25.0 bits (52), Expect = 2.5 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 614 LTVLPYSHTQQKTHNIAQF 670 LT L SH KT N+AQF Sbjct: 115 LTALNVSHNALKTFNVAQF 133 >EF519524-1|ABP73587.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 25.0 bits (52), Expect = 2.5 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 614 LTVLPYSHTQQKTHNIAQF 670 LT L SH KT N+AQF Sbjct: 115 LTALNVSHNALKTFNVAQF 133 >EF519520-1|ABP73583.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 25.0 bits (52), Expect = 2.5 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 614 LTVLPYSHTQQKTHNIAQF 670 LT L SH KT N+AQF Sbjct: 115 LTALNVSHNALKTFNVAQF 133 >EF519517-1|ABP73580.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 25.0 bits (52), Expect = 2.5 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 614 LTVLPYSHTQQKTHNIAQF 670 LT L SH KT N+AQF Sbjct: 115 LTALNVSHNALKTFNVAQF 133 >EF519516-1|ABP73579.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 25.0 bits (52), Expect = 2.5 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 614 LTVLPYSHTQQKTHNIAQF 670 LT L SH KT N+AQF Sbjct: 115 LTALNVSHNALKTFNVAQF 133 >EF519515-1|ABP73578.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 25.0 bits (52), Expect = 2.5 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 614 LTVLPYSHTQQKTHNIAQF 670 LT L SH KT N+AQF Sbjct: 115 LTALNVSHNALKTFNVAQF 133 >EF519514-1|ABP73577.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 25.0 bits (52), Expect = 2.5 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 614 LTVLPYSHTQQKTHNIAQF 670 LT L SH KT N+AQF Sbjct: 115 LTALNVSHNALKTFNVAQF 133 >EF519513-1|ABP73576.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 25.0 bits (52), Expect = 2.5 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 614 LTVLPYSHTQQKTHNIAQF 670 LT L SH KT N+AQF Sbjct: 115 LTALNVSHNALKTFNVAQF 133 >EF519512-1|ABP73575.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 25.0 bits (52), Expect = 2.5 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 614 LTVLPYSHTQQKTHNIAQF 670 LT L SH KT N+AQF Sbjct: 115 LTALNVSHNALKTFNVAQF 133 >EF519511-1|ABP73574.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 25.0 bits (52), Expect = 2.5 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 614 LTVLPYSHTQQKTHNIAQF 670 LT L SH KT N+AQF Sbjct: 115 LTALNVSHNALKTFNVAQF 133 >EF519510-1|ABP73573.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 25.0 bits (52), Expect = 2.5 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 614 LTVLPYSHTQQKTHNIAQF 670 LT L SH KT N+AQF Sbjct: 115 LTALNVSHNALKTFNVAQF 133 >EF519509-1|ABP73572.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 25.0 bits (52), Expect = 2.5 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 614 LTVLPYSHTQQKTHNIAQF 670 LT L SH KT N+AQF Sbjct: 115 LTALNVSHNALKTFNVAQF 133 >EF519508-1|ABP73571.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 25.0 bits (52), Expect = 2.5 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 614 LTVLPYSHTQQKTHNIAQF 670 LT L SH KT N+AQF Sbjct: 115 LTALNVSHNALKTFNVAQF 133 >EF519507-1|ABP73570.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 25.0 bits (52), Expect = 2.5 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 614 LTVLPYSHTQQKTHNIAQF 670 LT L SH KT N+AQF Sbjct: 115 LTALNVSHNALKTFNVAQF 133 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 25.0 bits (52), Expect = 2.5 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 3/26 (11%) Frame = -1 Query: 552 TVLNKVMLYSESVCEWWPQA---SSC 484 T+ K +YSE + EW P A SSC Sbjct: 127 TLATKATIYSEGLVEWKPPAIYKSSC 152 >EF519526-1|ABP73589.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.6 bits (51), Expect = 3.3 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 614 LTVLPYSHTQQKTHNIAQF 670 LT L SH KT N+AQF Sbjct: 115 LTXLNVSHNALKTFNVAQF 133 >EF519525-1|ABP73588.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.6 bits (51), Expect = 3.3 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 614 LTVLPYSHTQQKTHNIAQF 670 LT L SH KT N+AQF Sbjct: 115 LTXLNVSHNALKTFNVAQF 133 >EF519523-1|ABP73586.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.6 bits (51), Expect = 3.3 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 614 LTVLPYSHTQQKTHNIAQF 670 LT L SH KT N+AQF Sbjct: 115 LTXLNVSHNALKTFNVAQF 133 >EF519522-1|ABP73585.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.6 bits (51), Expect = 3.3 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 614 LTVLPYSHTQQKTHNIAQF 670 LT L SH KT N+AQF Sbjct: 115 LTXLNVSHNALKTFNVAQF 133 >EF519521-1|ABP73584.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.6 bits (51), Expect = 3.3 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 614 LTVLPYSHTQQKTHNIAQF 670 LT L SH KT N+AQF Sbjct: 115 LTXLNVSHNALKTFNVAQF 133 >EF519519-1|ABP73582.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.6 bits (51), Expect = 3.3 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 614 LTVLPYSHTQQKTHNIAQF 670 LT L SH KT N+AQF Sbjct: 115 LTXLNVSHNALKTFNVAQF 133 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +1 Query: 1 FFFSNNILLSHWLSICIQK*ANGKSLTVLDR 93 F N ILL+ +L+I + A+ SLT +++ Sbjct: 699 FICGNYILLNVFLAIAVDNLADADSLTTVEK 729 >EF427621-5|ABO09853.1| 62|Anopheles gambiae tal-like protein AA protein. Length = 62 Score = 23.4 bits (48), Expect = 7.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 Query: 587 PGSAVHTSQLTVLPYSHTQQKTH 655 PGS +SQ + + H QQ+ H Sbjct: 14 PGSGASSSQRSPFHHHHQQQQNH 36 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 816,163 Number of Sequences: 2352 Number of extensions: 15325 Number of successful extensions: 65 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 62 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78170964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -