BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0713 (756 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U88168-3|AAC24397.1| 204|Caenorhabditis elegans Ribosomal prote... 108 4e-24 >U88168-3|AAC24397.1| 204|Caenorhabditis elegans Ribosomal protein, large subunitprotein 15 protein. Length = 204 Score = 108 bits (260), Expect = 4e-24 Identities = 47/83 (56%), Positives = 61/83 (73%) Frame = -2 Query: 506 GGRKRPVAKGATYGKPKSHGVNQLKPTRNLQSIAEEXXXXXXXXXXXLSSYWVAQDSSYK 327 G RKRPV KG TYGKPK+HGVN+LK ++ Q++AE L+SYWVA+DS+YK Sbjct: 69 GNRKRPVCKGQTYGKPKTHGVNELKNAKSKQAVAEGRAGRRLGSLRVLNSYWVAEDSTYK 128 Query: 326 YFEVILVDPSHKAIRRDPKINWI 258 ++EV+L+DP HKAIRR+P WI Sbjct: 129 FYEVVLIDPFHKAIRRNPDTQWI 151 Score = 103 bits (248), Expect = 1e-22 Identities = 42/59 (71%), Positives = 53/59 (89%) Frame = -3 Query: 709 MGAYRYIQELYRKKLSDVMRFLLRVRVWQYRQLTRMHRAPRPTRPDKARRLGYRAKQGY 533 MGAY+Y+QE++RKK SD +R+LLR+R W YRQL+ +HR PRPTRP+KARRLGYRAKQG+ Sbjct: 1 MGAYKYMQEIWRKKQSDALRYLLRIRTWHYRQLSAVHRVPRPTRPEKARRLGYRAKQGF 59 Score = 75.4 bits (177), Expect = 4e-14 Identities = 34/50 (68%), Positives = 38/50 (76%) Frame = -1 Query: 249 VHKHREMRGLTSAGRSSRGLGKGHRYSQTKGGSRRAAWLRRNTLQLRRKR 100 VHKHRE RGLTSAGR SRGLGKG R+S T+GGS+ W R+NT RKR Sbjct: 155 VHKHREQRGLTSAGRKSRGLGKGWRFSATRGGSQAKNWKRKNTKVFHRKR 204 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,586,609 Number of Sequences: 27780 Number of extensions: 366277 Number of successful extensions: 1047 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 984 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1046 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1798543458 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -