BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0712 (790 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1417 - 26922775-26922986,26923102-26923291,26923816-269239... 28 9.7 01_06_0124 - 26692731-26697046,26698749-26698827,26698899-266989... 28 9.7 >08_02_1417 - 26922775-26922986,26923102-26923291,26923816-26923928, 26924032-26924112,26925329-26926661 Length = 642 Score = 27.9 bits (59), Expect = 9.7 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = -1 Query: 439 LAANVRKRSHSIQI*ANFYAIENLKRLALSPLVLNSYCSLWKSCN 305 +A + R S+ + + F+A+ LA VLN+ +++ SCN Sbjct: 10 IAISAAARVPSLDVGSQFHALSLKLSLASDSFVLNALINMYSSCN 54 >01_06_0124 - 26692731-26697046,26698749-26698827,26698899-26698955, 26699321-26699416 Length = 1515 Score = 27.9 bits (59), Expect = 9.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +2 Query: 152 DMFTLYHCTILLYYWLSTGCYTIW 223 + F L+ + +YYWL G + IW Sbjct: 47 EAFRLFLLSTSVYYWLGKGSFVIW 70 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,285,781 Number of Sequences: 37544 Number of extensions: 332368 Number of successful extensions: 555 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 549 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 555 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2127163404 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -