BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0710 (759 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR533537-1|CAG38568.1| 463|Homo sapiens UBE1C protein. 33 0.85 AL096713-1|CAB46370.1| 1430|Homo sapiens hypothetical protein pr... 31 6.0 >CR533537-1|CAG38568.1| 463|Homo sapiens UBE1C protein. Length = 463 Score = 33.5 bits (73), Expect = 0.85 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = -3 Query: 595 FINNTITNFLCTVTTHIYTISDSQSTFLRRFF*INCYLCALL 470 F+N+ + N C V H Y I D TF R+F I C L +++ Sbjct: 131 FLNDRVPN--CNVVPHFYKIQDFNDTFYRQFHIIVCGLDSII 170 >AL096713-1|CAB46370.1| 1430|Homo sapiens hypothetical protein protein. Length = 1430 Score = 30.7 bits (66), Expect = 6.0 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 3/41 (7%) Frame = -1 Query: 156 LNLHAYNTQQ-VPKYVQS--LEKIFEPNIDSYYSTCVIGNS 43 L LH TQ VP++V++ L F+PNI YY +I N+ Sbjct: 1126 LALHILRTQGLVPEHVETRTLHSTFQPNISRYYLRVIIWNT 1166 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,023,229 Number of Sequences: 237096 Number of extensions: 1637244 Number of successful extensions: 1832 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1778 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1832 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 9183116696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -