BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0710 (759 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 23 2.4 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 23 3.1 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 23 3.1 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 22 7.2 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 23.4 bits (48), Expect = 2.4 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -3 Query: 280 YYPKLLFWVTGTNK*YYYKSTYISFILAKL*DIR 179 YYP L W+ + YY ST I+ IL L I+ Sbjct: 301 YYPDLNEWLYILSGCLYYFSTTINPILYNLMSIK 334 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 108 FVHTLGLAVYYMRVNSA 158 F +GLA YY +VN A Sbjct: 212 FTQDIGLAAYYAQVNLA 228 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 23.0 bits (47), Expect = 3.1 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -2 Query: 338 KNCFNNPGVYEWSLNLYQLILSQTV 264 KNC ++ ++E NL++ I Q + Sbjct: 316 KNCADSGSIWETGKNLFEFIRKQVL 340 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.8 bits (44), Expect = 7.2 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +2 Query: 593 EWPFSYYTK*CIMTNKFHSNYFSG 664 +W F Y+K + NK S+ +G Sbjct: 383 QWQFDVYSKDVELANKMESSGMAG 406 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,650 Number of Sequences: 438 Number of extensions: 4075 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23875740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -