BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0707 (758 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 146 2e-35 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 70 2e-12 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 70 2e-12 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 56 3e-08 SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) 52 7e-07 SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 7e-07 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) 40 0.003 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 40 0.003 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 39 0.004 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 39 0.005 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 38 0.007 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 36 0.027 SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.77 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.77 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 31 1.3 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 29 3.1 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_24445| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_6602| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 146 bits (354), Expect = 2e-35 Identities = 83/164 (50%), Positives = 96/164 (58%) Frame = +2 Query: 257 RKDPNSPLYSVKTFEALHLKPNLLKGVYAMGFNAPSKIQETALPTLLADPPQNMIAQSQS 436 R DP+SPLYS K+FE L L NL +GVY MGFN PSKIQETALP LLADPP NMIAQSQS Sbjct: 92 RSDPSSPLYSAKSFEELPLSANLRRGVYDMGFNKPSKIQETALPMLLADPPVNMIAQSQS 151 Query: 437 GTGKTAAFVLAMLSRVDSNKNYPQYCVLVPHMN*PYKLVKLLQKWQNFVLK*S*SMQLEG 616 GTGKTAAFVL MLSRVD+ K YPQ L P + K+ + + + G Sbjct: 152 GTGKTAAFVLTMLSRVDATKPYPQVICLSPTYELARQTGKVAEAMGKHCPHIKINYAVRG 211 Query: 617 KNFPGVQKSQITFLLVLQERCLIGVSSLACLIWVKLKFFVLDEA 748 FP QK ++ L + C K+ FVLDEA Sbjct: 212 NQFPRGQKCTDHIIIGTPGTLLDWIRKSKCFEPRKVSVFVLDEA 255 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 70.1 bits (164), Expect = 2e-12 Identities = 35/77 (45%), Positives = 53/77 (68%) Frame = +2 Query: 296 FEALHLKPNLLKGVYAMGFNAPSKIQETALPTLLADPPQNMIAQSQSGTGKTAAFVLAML 475 FE LK LL G++ GF+ PS IQE ++P LA ++++A++++GTGKTAA+++ +L Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAG--RDILARAKNGTGKTAAYLVPLL 106 Query: 476 SRVDSNKNYPQYCVLVP 526 R D+ KN Q VLVP Sbjct: 107 ERTDTTKNCIQALVLVP 123 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 70.1 bits (164), Expect = 2e-12 Identities = 35/77 (45%), Positives = 53/77 (68%) Frame = +2 Query: 296 FEALHLKPNLLKGVYAMGFNAPSKIQETALPTLLADPPQNMIAQSQSGTGKTAAFVLAML 475 FE LK LL G++ GF+ PS IQE ++P LA ++++A++++GTGKTAA+++ +L Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAG--RDILARAKNGTGKTAAYLVPLL 106 Query: 476 SRVDSNKNYPQYCVLVP 526 R D+ KN Q VLVP Sbjct: 107 ERTDTTKNCIQALVLVP 123 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 56.0 bits (129), Expect = 3e-08 Identities = 32/77 (41%), Positives = 43/77 (55%) Frame = +2 Query: 296 FEALHLKPNLLKGVYAMGFNAPSKIQETALPTLLADPPQNMIAQSQSGTGKTAAFVLAML 475 F +L L P LL+G+ GF PS IQ A+P L ++IAQ++SGTGKT F + L Sbjct: 15 FHSLLLSPTLLRGLNEAGFEKPSPIQLKAIP--LGRCGLDLIAQAKSGTGKTCVFSVIAL 72 Query: 476 SRVDSNKNYPQYCVLVP 526 V + N Q +L P Sbjct: 73 ENVITESNCIQIIILTP 89 Score = 28.7 bits (61), Expect = 5.4 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Frame = +1 Query: 523 PTYELAIQTGEVAAKMAKFCPEIKLKYAVRGEELPRGSKITD--HILIGTPGKM 678 PT E+A+Q +V + + K + G L K HI +GTPG++ Sbjct: 89 PTREIAVQVKDVICAIGCHYDGLACKVFIGGISLEEDKKALKSCHIAVGTPGRV 142 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 53.2 bits (122), Expect = 2e-07 Identities = 27/60 (45%), Positives = 39/60 (65%) Frame = +2 Query: 347 GFNAPSKIQETALPTLLADPPQNMIAQSQSGTGKTAAFVLAMLSRVDSNKNYPQYCVLVP 526 GF PS IQ+ A+ +L +++IAQ+QSGTGKTA F +++L +D+ PQ VL P Sbjct: 16 GFEKPSAIQQRAIKPILKG--RDVIAQAQSGTGKTATFSISVLQAIDTQLREPQALVLSP 73 Score = 27.9 bits (59), Expect = 9.5 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Frame = +1 Query: 523 PTYELAIQTGEVAAKMAKFCPEIKLKYAVRGEELPRGSKITD---HILIGTPGKMFD 684 PT ELA Q +V + + ++ + G + + D HI+ GTPG++FD Sbjct: 73 PTRELANQIQKVVLALGDYM-SVQCHACIGGTNIGEDIRKLDYGQHIVSGTPGRVFD 128 >SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 52.8 bits (121), Expect = 3e-07 Identities = 33/89 (37%), Positives = 51/89 (57%), Gaps = 20/89 (22%) Frame = +2 Query: 287 VKTFEALHLKPNLLKGVYAMGFNAPSKIQETAL-PTLLADPP------------------ 409 V++F+ ++LK LL+G+YA GF PS IQ+ A+ P P Sbjct: 62 VESFDDMNLKEALLRGIYAYGFEKPSAIQQRAIRPCCQEFSPSHVCYNQLNLTKNHYVLS 121 Query: 410 -QNMIAQSQSGTGKTAAFVLAMLSRVDSN 493 +++IAQ+QSGTGKTA F +++L +D+N Sbjct: 122 ARDVIAQAQSGTGKTATFAISILQEIDTN 150 Score = 32.3 bits (70), Expect = 0.44 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 3/73 (4%) Frame = +1 Query: 523 PTYELAIQTGEVAAKMAKFCPEIKLKYAVRGEELPRGS-KITD--HILIGTPGKMFDWGV 693 PT ELA Q +V + + +K + G + K+ + H+++GTPG++FD + Sbjct: 167 PTRELAQQIQKVVLALGDYM-HVKCHACIGGTNVREDRMKLEEGVHVVVGTPGRVFDM-I 224 Query: 694 KFGMFDMGKIKVF 732 G+ + IK+F Sbjct: 225 NRGVLNTRDIKLF 237 >SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) Length = 475 Score = 51.6 bits (118), Expect = 7e-07 Identities = 28/79 (35%), Positives = 44/79 (55%), Gaps = 2/79 (2%) Frame = +2 Query: 257 RKDPNSPLYSVKT--FEALHLKPNLLKGVYAMGFNAPSKIQETALPTLLADPPQNMIAQS 430 +KD S+ + F LKP LL+ + GF PS++Q +P + ++I Q+ Sbjct: 34 KKDVKGTYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILG--MDIICQA 91 Query: 431 QSGTGKTAAFVLAMLSRVD 487 +SG GKTA FVLA L +++ Sbjct: 92 KSGMGKTAVFVLATLQQLE 110 >SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 51.6 bits (118), Expect = 7e-07 Identities = 28/79 (35%), Positives = 44/79 (55%), Gaps = 2/79 (2%) Frame = +2 Query: 257 RKDPNSPLYSVKT--FEALHLKPNLLKGVYAMGFNAPSKIQETALPTLLADPPQNMIAQS 430 +KD S+ + F LKP LL+ + GF PS++Q +P + ++I Q+ Sbjct: 34 KKDVKGTYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILG--MDIICQA 91 Query: 431 QSGTGKTAAFVLAMLSRVD 487 +SG GKTA FVLA L +++ Sbjct: 92 KSGMGKTAVFVLATLQQLE 110 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 45.2 bits (102), Expect = 6e-05 Identities = 23/63 (36%), Positives = 41/63 (65%) Frame = +2 Query: 296 FEALHLKPNLLKGVYAMGFNAPSKIQETALPTLLADPPQNMIAQSQSGTGKTAAFVLAML 475 FE + L LL V G+ P+ +Q+ A+P + ++++A +Q+G+GKTAAF++ +L Sbjct: 877 FEDVDLGEILLHNVGLAGYKKPTPVQKYAIP--IVKGKRDLMACAQTGSGKTAAFLIPIL 934 Query: 476 SRV 484 SR+ Sbjct: 935 SRI 937 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 45.2 bits (102), Expect = 6e-05 Identities = 21/70 (30%), Positives = 45/70 (64%) Frame = +2 Query: 269 NSPLYSVKTFEALHLKPNLLKGVYAMGFNAPSKIQETALPTLLADPPQNMIAQSQSGTGK 448 N+P+ + +FE +L L V + P+ +Q+ ++P ++A ++++A +Q+G+GK Sbjct: 704 NNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAG--RDVMACAQTGSGK 761 Query: 449 TAAFVLAMLS 478 TAAF+L +++ Sbjct: 762 TAAFLLPVMT 771 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/74 (31%), Positives = 44/74 (59%), Gaps = 1/74 (1%) Frame = +2 Query: 287 VKTFEALHLKPNLLKGVYAMGFNAPSKIQETALPTLLADPPQNMIAQSQSGTGKTAAFVL 466 + +F L L+ + G+ P+ +Q+ ALP ++A ++++A +Q+G+GKTAA++L Sbjct: 478 ITSFNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAG--RDLMACAQTGSGKTAAYML 535 Query: 467 AML-SRVDSNKNYP 505 +L S + N P Sbjct: 536 PVLTSLIKQGLNAP 549 Score = 28.7 bits (61), Expect = 5.4 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 3/58 (5%) Frame = +1 Query: 523 PTYELAIQTGEVAAKMAKFCPEIKLKYAVRGEELP-RGSKITD--HILIGTPGKMFDW 687 PT ELA Q A K + P IK+ G +P + S++ H L+GTPG++ D+ Sbjct: 560 PTRELAKQIYIEARKFSDHTP-IKVCVCYGGVSVPYQASQLERGCHFLVGTPGRLQDF 616 >SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) Length = 559 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/57 (33%), Positives = 35/57 (61%) Frame = +2 Query: 296 FEALHLKPNLLKGVYAMGFNAPSKIQETALPTLLADPPQNMIAQSQSGTGKTAAFVL 466 F + P L++ + MG P IQE ALP++ + ++++ +S++GTGK+ F+L Sbjct: 162 FSNFGVHPKLVEKLKKMGITKPVPIQEKALPSVFSH--KSLLIKSETGTGKSLVFLL 216 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/64 (34%), Positives = 37/64 (57%) Frame = +2 Query: 293 TFEALHLKPNLLKGVYAMGFNAPSKIQETALPTLLADPPQNMIAQSQSGTGKTAAFVLAM 472 +F L L L+ AMG P++IQ +P +L ++ I +++G+GKTAAF L + Sbjct: 8 SFAGLGLNKWLVSQCVAMGIKKPTEIQLNCVPPILQG--RDCIGCAKTGSGKTAAFALPI 65 Query: 473 LSRV 484 L ++ Sbjct: 66 LQKL 69 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 39.1 bits (87), Expect = 0.004 Identities = 23/89 (25%), Positives = 49/89 (55%), Gaps = 9/89 (10%) Frame = +2 Query: 287 VKTFEALHLKPNLLKGVYAMGFNAPSKIQETALPTLLADPPQNMIAQSQSGTGKTAAFVL 466 V +F L L+ ++LK + A+ + P+ IQ +P ++ ++I +Q+G+GKT A++ Sbjct: 377 VYSFAGLGLRDDVLKALDALNIHQPTVIQMVTIPKIIHR--HHVICAAQTGSGKTLAYLA 434 Query: 467 AMLSRVDSNK---------NYPQYCVLVP 526 ++ R+ ++ P+ C++VP Sbjct: 435 PLVHRLREDEERHGILARLKRPRACIVVP 463 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/65 (27%), Positives = 41/65 (63%) Frame = +2 Query: 281 YSVKTFEALHLKPNLLKGVYAMGFNAPSKIQETALPTLLADPPQNMIAQSQSGTGKTAAF 460 + ++ ++ + ++L+ V +G+ P+ IQ A+P L + +++I +++G+GKTAAF Sbjct: 98 FPIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQN--RDIIGVAETGSGKTAAF 155 Query: 461 VLAML 475 + +L Sbjct: 156 AIPLL 160 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/52 (38%), Positives = 33/52 (63%) Frame = +2 Query: 329 KGVYAMGFNAPSKIQETALPTLLADPPQNMIAQSQSGTGKTAAFVLAMLSRV 484 + V +GF P+ IQ + +P L +++ A + +GTGKTAAF+L +L R+ Sbjct: 23 RAVNELGFLHPTPIQASTIPVALMG--KDVCACAATGTGKTAAFMLPILERL 72 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 36.3 bits (80), Expect = 0.027 Identities = 17/61 (27%), Positives = 37/61 (60%) Frame = +2 Query: 269 NSPLYSVKTFEALHLKPNLLKGVYAMGFNAPSKIQETALPTLLADPPQNMIAQSQSGTGK 448 N+P+ + +FE +L L V + P+ +Q+ ++P ++A ++++A +Q+G+GK Sbjct: 127 NNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAG--RDVMACAQTGSGK 184 Query: 449 T 451 T Sbjct: 185 T 185 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 31.5 bits (68), Expect = 0.77 Identities = 16/54 (29%), Positives = 33/54 (61%) Frame = +2 Query: 323 LLKGVYAMGFNAPSKIQETALPTLLADPPQNMIAQSQSGTGKTAAFVLAMLSRV 484 ++ + + + P++IQ ALP L+ +++I +++G+GKTAAF+ L + Sbjct: 528 MMASIRKLEYTQPTQIQCQALPIALSG--RDIIGIAKTGSGKTAAFLWPALVHI 579 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 31.5 bits (68), Expect = 0.77 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 3/69 (4%) Frame = +1 Query: 523 PTYELAIQTGEVAAKMAKFCPEIKLKYAVRGEELPRGSKI---TDHILIGTPGKMFDWGV 693 PT ELA+Q + K AK+ +K+ V G P+ ++ I++ TPG++ W + Sbjct: 226 PTRELALQVKDHLVKAAKY-TSVKVAAIVGGMAAPKQQRLLKQRPEIVVATPGRL--WEL 282 Query: 694 KFGMFDMGK 720 +F GK Sbjct: 283 ISQVFTHGK 291 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 30.7 bits (66), Expect = 1.3 Identities = 22/59 (37%), Positives = 29/59 (49%), Gaps = 5/59 (8%) Frame = +1 Query: 523 PTYELAIQTGEVAAKMAKFCPEIKLKYAVRGEELPRGSKITD-----HILIGTPGKMFD 684 PT ELA Q EVA + K C KL+ P+G +I + I I TPG++ D Sbjct: 140 PTRELAQQVQEVAYSVGKHC---KLRSTCIYGGAPKGPQIRELERGVEICIATPGRLID 195 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 29.5 bits (63), Expect = 3.1 Identities = 10/29 (34%), Positives = 21/29 (72%) Frame = +2 Query: 410 QNMIAQSQSGTGKTAAFVLAMLSRVDSNK 496 +++I Q+++GTGKT +F L ++ ++ K Sbjct: 111 EDVIGQARTGTGKTLSFALPLVEKLQDGK 139 Score = 29.5 bits (63), Expect = 3.1 Identities = 23/70 (32%), Positives = 36/70 (51%), Gaps = 2/70 (2%) Frame = +1 Query: 523 PTYELAIQTGEVAAKMAKFCPEIKLKYAVRGEELPRGSKITD--HILIGTPGKMFDWGVK 696 PT ELA Q G + K E+ Y E P+ + I +L+GTPG++ D+ ++ Sbjct: 155 PTRELAKQVGNEFENL-KSNLEVYCIYGGMPYE-PQENAINSGLDVLVGTPGRILDF-MR 211 Query: 697 FGMFDMGKIK 726 G D+ K+K Sbjct: 212 QGTLDLSKLK 221 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 29.1 bits (62), Expect = 4.1 Identities = 9/28 (32%), Positives = 23/28 (82%) Frame = +2 Query: 410 QNMIAQSQSGTGKTAAFVLAMLSRVDSN 493 ++++A +++G+GKTAAF++ M ++ ++ Sbjct: 319 KDVVAMARTGSGKTAAFLIPMFEKLQTH 346 >SB_24445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 437 GTGKTAAFVLAMLSRVDSNKNYPQYCVLVP 526 G + +A LS+VDSNK YP +VP Sbjct: 241 GIVSSYGLAIAFLSQVDSNKPYPALVSIVP 270 >SB_6602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 863 Score = 28.7 bits (61), Expect = 5.4 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 492 LESTLLNIAKTKAAVFPVPDCDWAI 418 +E+T N +A +PVPD DW I Sbjct: 568 IEATFANFTCPEAFGYPVPDVDWVI 592 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,865,998 Number of Sequences: 59808 Number of extensions: 456823 Number of successful extensions: 944 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 865 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 932 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2070332524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -