BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0705 (542 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P23316 Cluster: Chitin synthase 1; n=37; Fungi|Rep: Chi... 33 5.6 >UniRef50_P23316 Cluster: Chitin synthase 1; n=37; Fungi|Rep: Chitin synthase 1 - Candida albicans (Yeast) Length = 776 Score = 32.7 bits (71), Expect = 5.6 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 307 RWTNGHYFSGLVELQNFLKMWMGQYYFIRLF 399 RW NG +F+ L L +F K+W + + R F Sbjct: 410 RWINGAFFAALYSLYHFRKIWTTDHSYARKF 440 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 530,476,183 Number of Sequences: 1657284 Number of extensions: 10367287 Number of successful extensions: 19678 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 19178 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19673 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 34989170748 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -