BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0705 (542 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC18B5.08c |||isoleucine-tRNA ligase|Schizosaccharomyces pombe... 27 2.4 SPAC3G6.01 |hrp3||ATP-dependent DNA helicase Hrp3|Schizosaccharo... 26 4.1 SPAC664.06 |rpl703|rpl7|60S ribosomal protein L7|Schizosaccharom... 25 5.5 SPAPB18E9.01 |trm5||tRNA |Schizosaccharomyces pombe|chr 1|||Manual 25 7.2 SPBP35G2.10 |mit1||SHREC complex subunit Mit1|Schizosaccharomyce... 25 7.2 SPBPJ4664.04 |||coatomer alpha subunit |Schizosaccharomyces pomb... 25 9.5 SPCC970.07c |raf2|dos2, cmc2, clr7|Rik1-associated factor Raf2|S... 25 9.5 >SPCC18B5.08c |||isoleucine-tRNA ligase|Schizosaccharomyces pombe|chr 3|||Manual Length = 973 Score = 26.6 bits (56), Expect = 2.4 Identities = 9/27 (33%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +2 Query: 368 GWGNTILFVYLIYSNRPRIPFK-MYIH 445 GW ++L Y Y ++P PF ++ H Sbjct: 589 GWFQSLLLTYTAYQSKPEAPFSTLFTH 615 >SPAC3G6.01 |hrp3||ATP-dependent DNA helicase Hrp3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1388 Score = 25.8 bits (54), Expect = 4.1 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = +3 Query: 21 PATVIVPTNTVAIWQSEIRLVYNMLNFIL*LF*IKPYTILRTFREGQEGT 170 P V+VP +TV WQ + L + +N I L ++R + +GT Sbjct: 426 PFLVVVPLSTVPAWQETLALWASDMNCISYLGNTTSRQVIRDYEFYVDGT 475 >SPAC664.06 |rpl703|rpl7|60S ribosomal protein L7|Schizosaccharomyces pombe|chr 1|||Manual Length = 249 Score = 25.4 bits (53), Expect = 5.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 522 YDYPQWHHVLQLLYKRGY 469 Y P H V +L+YKRG+ Sbjct: 142 YGIPNLHSVRELIYKRGF 159 >SPAPB18E9.01 |trm5||tRNA |Schizosaccharomyces pombe|chr 1|||Manual Length = 435 Score = 25.0 bits (52), Expect = 7.2 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 360 QEILQFNKSRKIMTISPPCHRA 295 Q++L F+K K +T+ PP RA Sbjct: 307 QKLLGFSKDEKAITVFPPRKRA 328 >SPBP35G2.10 |mit1||SHREC complex subunit Mit1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1418 Score = 25.0 bits (52), Expect = 7.2 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 21 PATVIVPTNTVAIWQSEIR 77 P VIVP TVA W+ E++ Sbjct: 606 PVLVIVPHATVANWERELK 624 >SPBPJ4664.04 |||coatomer alpha subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 1207 Score = 24.6 bits (51), Expect = 9.5 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = -2 Query: 205 WLAPCRGGLKLQVPSWPSRNVLSIV*G 125 W+ C +++ +W SRN ++I+ G Sbjct: 109 WILSCSDDQTIRIWNWQSRNCIAILTG 135 >SPCC970.07c |raf2|dos2, cmc2, clr7|Rik1-associated factor Raf2|Schizosaccharomyces pombe|chr 3|||Manual Length = 636 Score = 24.6 bits (51), Expect = 9.5 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -1 Query: 299 GHCMSNVCVHNNNNKASITLLLLTLMC 219 G+C + +H NN + + LL TL+C Sbjct: 376 GYCYDYLFMHCNNGEKTSLHLLRTLIC 402 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,199,567 Number of Sequences: 5004 Number of extensions: 43678 Number of successful extensions: 99 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 98 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 99 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 223909422 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -