BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0705 (542 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0816 + 6360526-6360802,6360902-6361117,6361231-6361379,636... 28 4.2 11_06_0683 + 26259129-26259968 27 7.3 >01_01_0816 + 6360526-6360802,6360902-6361117,6361231-6361379, 6361474-6361750,6362228-6362457 Length = 382 Score = 28.3 bits (60), Expect = 4.2 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -1 Query: 272 HNNNNKASITLLLLTL-MCSYRLLASTVSGRPKASGAF 162 H+ +NK ++ LLLL L C++ A+ SG PK F Sbjct: 3 HSPSNKMTLLLLLLLLLGCTHHGQANMYSGHPKIDSIF 40 >11_06_0683 + 26259129-26259968 Length = 279 Score = 27.5 bits (58), Expect = 7.3 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 Query: 254 LYYCCCVHIHCSCNARWH 307 L+YC C H HC C H Sbjct: 232 LHYCHCTHGHCHCAGGRH 249 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,014,927 Number of Sequences: 37544 Number of extensions: 272200 Number of successful extensions: 511 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 504 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 510 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1210221432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -