BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0705 (542 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT009932-1|AAQ22401.1| 952|Drosophila melanogaster SD08871p pro... 30 2.4 AE014298-935|AAF46190.2| 1034|Drosophila melanogaster CG14442-PA... 30 2.4 AY051555-1|AAK92979.1| 604|Drosophila melanogaster GH20501p pro... 28 9.5 AE013599-1597|AAF58448.2| 604|Drosophila melanogaster CG3790-PA... 28 9.5 >BT009932-1|AAQ22401.1| 952|Drosophila melanogaster SD08871p protein. Length = 952 Score = 29.9 bits (64), Expect = 2.4 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = -3 Query: 381 VLPHPHFQEILQFNKSRKIMTISPPCHRALHEQ 283 ++PHPH + I+ N+ +++TIS + LH+Q Sbjct: 865 LVPHPHHEAIV-LNQQHRLVTISQHQQQQLHQQ 896 >AE014298-935|AAF46190.2| 1034|Drosophila melanogaster CG14442-PA protein. Length = 1034 Score = 29.9 bits (64), Expect = 2.4 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = -3 Query: 381 VLPHPHFQEILQFNKSRKIMTISPPCHRALHEQ 283 ++PHPH + I+ N+ +++TIS + LH+Q Sbjct: 947 LVPHPHHEAIV-LNQQHRLVTISQHQQQQLHQQ 978 >AY051555-1|AAK92979.1| 604|Drosophila melanogaster GH20501p protein. Length = 604 Score = 27.9 bits (59), Expect = 9.5 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 325 YFSGLVELQNFLKMWMGQYYFIRLFDLF 408 + +G VEL +L +W G YF R + LF Sbjct: 395 FLAGAVELPTYLLLWPGLSYFGRRWILF 422 >AE013599-1597|AAF58448.2| 604|Drosophila melanogaster CG3790-PA protein. Length = 604 Score = 27.9 bits (59), Expect = 9.5 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 325 YFSGLVELQNFLKMWMGQYYFIRLFDLF 408 + +G VEL +L +W G YF R + LF Sbjct: 395 FLAGAVELPTYLLLWPGLSYFGRRWILF 422 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,190,757 Number of Sequences: 53049 Number of extensions: 499178 Number of successful extensions: 1018 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 993 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1017 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 2074444800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -