BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0703 (694 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0944 + 22868885-22870387 31 1.1 03_05_0374 - 23589944-23590432,23590551-23590961,23591404-235915... 29 4.6 >08_02_0944 + 22868885-22870387 Length = 500 Score = 30.7 bits (66), Expect = 1.1 Identities = 19/42 (45%), Positives = 27/42 (64%), Gaps = 2/42 (4%) Frame = -1 Query: 532 LPLI*NMLHLVVFFPPRLAASYKTY-PILSL-VDLTTFPVMS 413 LPL+ N+L+L PP LA +TY P++ L + LTT V+S Sbjct: 41 LPLVGNLLNLRGHLPPALARLARTYGPVMMLKMGLTTTVVIS 82 >03_05_0374 - 23589944-23590432,23590551-23590961,23591404-23591535, 23591885-23591962 Length = 369 Score = 28.7 bits (61), Expect = 4.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 Query: 458 PYPIVGRPNYIPCHVSPIYS 399 PYP+V P Y+ H+SP +S Sbjct: 215 PYPLVFNPKYLKIHLSPEHS 234 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,418,361 Number of Sequences: 37544 Number of extensions: 254715 Number of successful extensions: 442 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 433 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 442 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1768474200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -