BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0703 (694 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28258| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_53172| Best HMM Match : ABC_tran (HMM E-Value=5.4e-40) 30 1.5 SB_56049| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_52261| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_32960| Best HMM Match : Ribonuc_red_sm (HMM E-Value=0) 28 8.3 >SB_28258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1234 Score = 31.5 bits (68), Expect = 0.67 Identities = 13/42 (30%), Positives = 26/42 (61%) Frame = -3 Query: 599 RRKVYKCGFLFMIVKNKTPHLDVATHIKHATFSSFFSPKVGR 474 RR+V + G LF + ++ H++ A+ + ++F + + P VGR Sbjct: 126 RREVKRYGVLFTCMASRAVHIETASSLDTSSFLNAYRPFVGR 167 >SB_53172| Best HMM Match : ABC_tran (HMM E-Value=5.4e-40) Length = 665 Score = 30.3 bits (65), Expect = 1.5 Identities = 21/73 (28%), Positives = 31/73 (42%), Gaps = 1/73 (1%) Frame = -3 Query: 629 Y*SYLITTKTRRKVYKCGFLFMIVKNKTP-HLDVATHIKHATFSSFFSPKVGRVVQNLPY 453 Y S I R ++ F +K T H +A + HA S F + VGR++ Sbjct: 503 YISLTIAANVLRYLFSFFIFFTALKCNTKLHNTMAQSLIHAPVSFFDTNPVGRILNRFSA 562 Query: 452 PIVGRPNYIPCHV 414 IV N +P H+ Sbjct: 563 DIVEIDNILPPHL 575 >SB_56049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 29.1 bits (62), Expect = 3.6 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +1 Query: 145 LCLLVLFMNCCHFYTYFFFSFQCCNVLKLKHH 240 L + +LF C F T F FS +C N L L +H Sbjct: 12 LFITILFPRCS-FTTLFHFSAECQNALTLDYH 42 >SB_52261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 761 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/42 (28%), Positives = 25/42 (59%) Frame = -3 Query: 599 RRKVYKCGFLFMIVKNKTPHLDVATHIKHATFSSFFSPKVGR 474 RR+V + G LF + ++ H++ A+ + ++F + + VGR Sbjct: 590 RREVKRYGVLFTCMASRDVHIETASSLDTSSFLNVYRSFVGR 631 >SB_32960| Best HMM Match : Ribonuc_red_sm (HMM E-Value=0) Length = 991 Score = 27.9 bits (59), Expect = 8.3 Identities = 16/67 (23%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Frame = -3 Query: 533 VATHIKHATFSSFFSPKVGRVVQNLPYPIVGRPNYIPCHVSPIYSDMKMNRA-DTLLEIS 357 +A HIKHA F P+ ++ P+ + ++P+ + ++++ A D Sbjct: 561 IAEHIKHAIAEQVFDPRSKVALRRARAPVESTAS----EITPLLTQLEIHVAEDKSFTTR 616 Query: 356 IKYIFLE 336 ++YIF E Sbjct: 617 VRYIFKE 623 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,925,115 Number of Sequences: 59808 Number of extensions: 325036 Number of successful extensions: 639 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 591 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 639 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -