BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0703 (694 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 24 1.6 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 23 3.6 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 8.4 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 23.8 bits (49), Expect = 1.6 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = -3 Query: 434 NYIPCHVSPIYSDMKMNRADTLLEISIKYIFLEIK 330 +Y H++P+++ K + DT E++++ IF E K Sbjct: 7 HYQHYHITPVFTKQKKVKEDT--ELNLQTIFNEDK 39 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 22.6 bits (46), Expect = 3.6 Identities = 8/31 (25%), Positives = 17/31 (54%) Frame = +3 Query: 480 NLGGKKTTKCSMFYMSGNIEVWRFVFHYHKQ 572 ++ TT C++ Y +GN + VF+ ++ Sbjct: 182 DISNNYTTDCTIEYSTGNFTCIQIVFNLRRR 212 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 72 DGVSTLNFITKLIFARVKLRDLY*TVSACT 161 DG+ L + L+FA + LR + V AC+ Sbjct: 131 DGLGWLLLMLYLLFATLPLRLSFCVVLACS 160 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,912 Number of Sequences: 438 Number of extensions: 3394 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21195810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -